SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI12G02910.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G02910.1
Domain Number 1 Region: 487-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 56-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.15e-26
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Domain Number 3 Region: 329-380
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000369
Family Anti-platelet protein 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI12G02910.1
Sequence length 785
Comment pep:novel chromosome:ALNW00000000:12:2632612:2635654:1 gene:OMERI12G02910 transcript:OMERI12G02910.1 description:""
Sequence
MPKSKSFVPAPISAVAGHANYLHKGSSLSAKHASDVLQSTDGTFSFGFYNLSSTVFTLSI
WFTNSADKTIVWSANQDRPVHESGSKVMLNKDGSMVLTDYDGTVVWQISSSAEAVRAELM
DSGNLVVKDQGGSILWQSFDHPTNTLLPMQPVTATAKLVSTDPSHPTSYYTLRFDDRYVL
SLAYDGPDIFNLYWPNPDQSSWTNYRISYNRSRSGVLDKLGKFMASDNTTFYASDWGLEI
KRRLTLDYDGNLRLYSLNESDGSWYNSWMAFSQPCEIHGLCGWNGICAYTPKIGCSCPPG
YVVSDPGDWSRGCKPAFNLTCSNDGQKMSFVRIPQTDFWGFDLNYVMSTSLHACRAMCLA
SCSCVAFVYKVYPNGCFLKSDLFNGKTVTGYPGAAYIKVPQSFLSRSQAHASELANRHVC
NSSKTQTFNYATQSNKGMGTMWYYYYCFLAAFFLVELCFIAFGWWFMAKTHSARSAIWAA
EEGYRVVTDHFRRFTYKELRRATRNFKDELGRGRYGSVYKGILDDNRIVAIKKLKDVKQG
EAEFQTEVSVIGSIYHMNLVRVMGVCSEGSHRLLVYEYVENGSLAMFLFGSKGLLQWQHR
YKVAVGVAKGLAYLHHECMDWIIHCDVKPENILLDQDFEPKISDFGFAKLLQRNQTDPNM
SKIRGTRGYIAPEWVSGVPITEKVDVYSYGVVLLELVMGLRMSELPANGSADEGAALRQL
VWTVTEKIKTGDQTLIDGVVDPRLNGNFVRSEVLLVLEFAVLCLEKERNQRPNMNHVVQK
FLSYE
Download sequence
Identical sequences A0A0E0FA37
OMERI12G02910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]