SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI12G03120.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G03120.1
Domain Number 1 Region: 539-834
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 78-226
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.13e-21
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  OMERI12G03120.1
Domain Number - Region: 372-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0188
Family Anti-platelet protein 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI12G03120.1
Sequence length 845
Comment pep:novel chromosome:ALNW00000000:12:2886624:2889161:-1 gene:OMERI12G03120 transcript:OMERI12G03120.1 description:""
Sequence
MSTSCSGALRAATTKALLLLVVVFVVVSLSRQFPCAAAARDSLLRGASIAVEDHATDVLL
SPDGTFSCGFYVVSPTVFTFSVWFARAADRAVVWSANRGRPVHSKRSRLKLNGRLRALVL
TDYDGEVVWNSTVSANATATATAVRARLHDSGNLAVEDASGNVLWQSFDHPTDTLLPTQR
IAAGEAMVSADKLLAAGFYSFRFSDYAMLSLVYDNHEMSSIYWPNPYYSYWQNSRKIYNF
TREAFFDASGHFSSSDNATFDASDLAKNVAVRRRLTLDTDGNLRLYSLDEVTGTWSVSWM
AFSNPCIIHGVCGANAVCLYSPAPVCVCAPGYARADPCDWSRGCRPTFNSSDDGGLLRAM
KMVALPHTDFWGFDINSSENLSLDECSTRCMSEPSCVVFQYKQGKGECYPKSLMFNGRTF
PGLPGTAYLKVPADLDMPEIHIHQWQTDSDGHGIAAIQEDIVGCGGMSSPEFLLNVSNVS
SSKSNQGKSIWFYFYGFLTAFFVIEVFVIAFGCWLFSNKGVFRPCQVSALDEGYRMVTNH
FRAYSYTELQKGTRKFQSEIGRGGSGVVYKGVLDDERTVAVKVLQDVKQSEDVFQAELSV
IGRIYHMNLVRMWGFCSEGIHRILVYEYIENGSLAKVLFQGRNSGMFLGWKQRFNIALGV
AKGLAYLHNECLEWIIHCDMKPENILLDEDMEPKITDFGLSKLLNRDGSGSDMSRIRGTR
GYMAPEWVSSLPITEKVDVYSYGVVLLELVKGMRISDWVLDGKEGLEADVRSVVKMVVSK
LESNMESWVADLMDDRLHGEFNHFQARLLMQLAVSCLEEDKNKRPTMKYIVQMLISAEDE
AHAFT
Download sequence
Identical sequences A0A0E0FA73
OMERI12G03120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]