SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI12G05300.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G05300.1
Domain Number 1 Region: 482-773
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.29e-62
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-25
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI12G05300.1
Sequence length 886
Comment pep:novel chromosome:ALNW00000000:12:5840929:5859712:1 gene:OMERI12G05300 transcript:OMERI12G05300.1 description:""
Sequence
MSTLSHQHHHVLVLQLILLLPLLHLVVPGTPAAAGKFSDVLASGRNVSDGDVLVSPGGSF
TLGFFSPAGATTRRRYLGIWFSVSPDAAVHWVANRDHALNDTSGTLTLTDASVLLLLDGS
GKVVWSSSTTAAPSVTTSAAARLLDTGNLVVHGQGSGTALWQSFDYPTNTLLPGMKIGKN
RWTGAEWYLLSWRSPADPSPGSYRYVTDGDEALPENVVLDGNGTEVYRTGVWNGRRFNGV
PEMASFADMFSFQLTVSSGEVTYGYVAKAGAPFSRVVVTDDGVVRRLVWDAATRAWKTFF
QAPGDSCDRYAKCGAFGLCDSNAGATSICRCVKGFSPASPAEWSMREYSGGCRRDVALDC
STDGFAVLRGVKLPDTRNASVDMGVKLDECRARCVANCSCVAYAAADLSGGGCIMWTKPF
VDLRFIDNGQDIYQRLAKSEIGRPPHWKFPVVITVAVVLVIIVVFVLVWAVKRKPREGGI
RRSVSPGITSIDRVTLQNATGNFAKKNLIGEGNYGRVYKGILPAESTITGSRQENEIVAV
KLLQPSGTGTFVAELEAMFNAIHVNLVRLLAFCSDNDDRHTGEKFRALVYEYMPNNSLHH
YIFAQNSELRAMLDWPLRLKIVDGIVEGIRYLHVGSNTPIIHRDLKPSNILLGRDWTPKI
SDFGLARGYTAPECWQLGRVEPESDVYSFGVILLEMISGKPNGLMQQLLPHVWNLWYNSG
GPDCTAELLDPEVPPPDEQSFRRLQICVKVGLLCVQESFQIRPNMSVVADMLRSQDMPPI
DPIRPTLRNMEVWNLWYNSGGPDCTAELLDPEVPPPDEQSFRRLQICVKVGLLCVQESFQ
IRPNMSVVADMLRSQDMPPIDPIRPTLRNMEVGQPSGTTATDEDLT
Download sequence
Identical sequences A0A0E0FAZ3
OMERI12G05300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]