SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI12G09860.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G09860.2
Domain Number 1 Region: 598-895
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-69
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 189-323
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-27
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  OMERI12G09860.2
Domain Number - Region: 449-500
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000114
Family Pan module (APPLE domain) 0.079
Further Details:      
 
Domain Number - Region: 394-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00247
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI12G09860.2
Sequence length 899
Comment pep:novel chromosome:ALNW00000000:12:14194070:14202475:1 gene:OMERI12G09860 transcript:OMERI12G09860.2 description:""
Sequence
MLRCPSCHFWLKGLGSGHLALAYHPGMLSWEIREPFNVFAKSFSNSALLGSNTQHSVEPC
ATQVILARDRSKFSNMRHIPSCRFITYKELRALHGPKASNTQHSVEPCAMQVILAWGRSK
FSNMRHLPFCRFITLSVIFLLSIPLLVASVPQDILSPGSSISVEDNSNMLVSPNGLFSCG
FYEVGANAFIFAVWVNQSIGKTVVWTADRDVPVNGRGSRIELWRDGNMVLLDFNSRLVWS
TGTTSGRVRSAKLLDTGNLVLLGHNGSRIWQSFDSPTDTLLPTQPIAANLKLVSGKYMLS
VDNNGSLALTYDTPEGRSKYWPRNINATPFSGDQPQGLDMLGCISAGNHIKYCASDLGYG
VLRRLTLDHDGNLRLYSLLEADGHWNISWIALADSCQVHGVCGNNGMCRNLMNPICACPP
GFVFADVSDLSKGCKPTFNISCDKVAQAYFVEIEKMSVWGYNSNYTASTTFNVCRKSCLD
DLHCEAFSYQYGLGGCTLRSSLYTGGFTPSEISFTCMKLTPDAAVQNSIDYKPHGPYLSC
QGRGFSTSADTKAFQWNYLYMPIGSIFAVEAILLPLAWCFLRKRRQDSISRNDGFALIRD
HFRKFTLKELVAATAKFKHEIGRGGSGVVYEGILDDGKKIAVKKLQDMVQGELDFQSELS
VIGRIYHMNLVRMWGFCSERGHKLLVFEYVENGSLAKLLFDTARLRWEQRLRVALGVARG
LAYLHHECLEWVIHCDVKPENILLDEELEPKLADFGLAKLLNRGKGVQMLSRVQGTRGYI
APEWASNLPITGKVDVYSFGVALLEIVRGLRVSDWTVVDGEEEEEEVEMVFRTTVTVLKE
RLRGEDRSWLAGFVDPRLDGNFCRLQAAAMVELAVTCVEEERSRRPNMKLVVEKLLNFL
Download sequence
Identical sequences OMERI12G09860.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]