SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trias1|370372|CE164276_33855 from Trichoderma asperellum CBS 433.97 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trias1|370372|CE164276_33855
Domain Number 1 Region: 215-643,676-752
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 6.41e-195
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000146
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.62e-69
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trias1|370372|CE164276_33855
Sequence length 902
Sequence
MYVRKRDGRQERVQFDKITARVSRLCYGLDTDHVDPVAITQKVISGVYGGVTTVQLDDLA
AETAAYMTVTHPDYAILAARIAVSNLHKQTKKQWSAVVSDLYHYVNPKNSRASPMISKDT
YECVMRHKEELDSAIVYDRDFNYQYFGFKTLERSYLLKLDGKIVERPQHMIMRVAVGIWG
DNIERVLETYHLMSSKFFTHASPTLFNAGTPQAQLSSCFLVDMKDDSIEGIYDTLKTCAM
ISKMAGGIGLNVHRIRATGSYIAGTNGTSNGIIPMLRVFNNTARYVDQGGNKRPGAFAIY
LEPWHADVFEFLDLRKNHGKEEVRARDLFLALWIPDLFMKRVEKNLDWTLMCPNECPGLA
DCYGEEFEALYEKYEKEGRGRKTIRAQKLWYSILEAQTETGNPFMLYKDSCNRKSNQKNL
GTIRSSNLCTEIIEYSAPDEVAVCNLASLALPAFVDYNEGCYDFKKLHEVTKVVVRNLNR
IIDVNYYPVQEARNSNSRHRPIGVGVQGLADAFLALRLPFESPEARELNKQIFETIYHAA
LEASMEIAKVEGPYSSFKGSPASEGILQYDMWDVKPTDLWEWDSLKEQIKEHGLRNSLLV
APMPTASTSQILGNNECFEPYTSNIYQRRVLAGEFQVVNPWLLKDLVDTGLWSDAMKNRI
IAENGSIQNIPNIPADIKALYKTVWEISQRQIVQMSADRGAFIDQSQSLNIHMKDPTMGK
ITSMHFTGWKLGLKTGMYYLRTQAAAAPIQFTVDQEALKVADANVSKERVLKKRAPPPGS
SFSMTSATAVPRLSSAKTEEVSGNSLSSTGIPTPTTTPPPLGRPLASPHKAPPMKADIEE
GDSPKVLPTEPSDNVKEEELNKKPDQTEDKNDDSEERERDIYSDAVLACSIENPESCVMC
SG
Download sequence
Identical sequences jgi|Trias1|370372|CE164276_33855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]