SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trias1|129379|e_gw1.2.1336.1 from Trichoderma asperellum CBS 433.97 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trias1|129379|e_gw1.2.1336.1
Domain Number 1 Region: 44-271
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.67e-64
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00023
Further Details:      
 
Domain Number 2 Region: 245-462
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.73e-52
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trias1|129379|e_gw1.2.1336.1
Sequence length 1124
Sequence
MDYARKRSRNAGEGDGSDGFGALESLSRPISPPRKKIRQVDMHKSPWQLTRVRDLPDEVN
KDTVSLKDLLGDPLIRECWQFNFLHDIPFVMNSFDESIKHLVMLHVVHGFWRRSDLSRIV
LSGDAAQYPNVHLHCAPMPEMFGTHHSKMMILFRSDSTAQIIIHTANMIPKDWTNMTNAV
WKSPKLPLLSEPDVIFQHGQVLPVGSGVRFKADLLSYLMLYDSYRVTCKPLADHLVNFDF
SSIRAAFIASVPGKHDFRDTSGPAWGWAGLQKCLRAVPVEPGESEIVAQISSIATLGAKD
DWLQRTLFDSLATSLTPNVKRPNFKVVFPTADEIRNSLDGYASGKSIHTKINSVQHIRQL
HYLQPMLHHWANDSKDGAEEYEEVLIRGDSGRNRAAPHVKTYIRFNQNNTIDWAMLTSAN
ISKQAWGDTLKLTTGEVRIASWEVGVLVWPGLLCEDGVMVSSFQSDTADMSFFSQAQRPI
KRPAIATMSPATNGNSGPSGHEHPAFSSSFRSGSPLAEQVLAQDIAACSDDDFDPADDLL
DPEQPHHFMYRRPSGVAYGAARPAFNPSGLEEPILTPLERKQSRDAERSLLRDNHVLPPK
HANKSQSLPARMYRKLFSTKVPVEESSDETDEDEPLLSRDPDRDYGTQPRRQRSEVEGEE
DVDEQWEEAITAGRIRTTWQREAKTVLSYCGPLIVTFFLQYSINVAGIFAVGRIGTIELG
AISLANMSQAISCLAPFQGLATSLDTLCAQAYGSGHKHLVGLQCQRMACFLLTLSVPVIM
LWLFGAEPILQRMVPNPESARLAALYLRVMIFAIPGVILFECGKRFTQAQGLFQATTYVL
LFAAPFNVFLTWLLVWKLEYGFVGAPMAVAITENILPLLLFCYVRFVNGRECWGGFSRRA
LNNWWVMIRLALPGMIMVEAEWLAFEILTLLASRFGSDYLAAQSVVSTIASISYQIPFPM
SIAASTRVANLIGAGLVDAARVTGKVTFVIHCILGLLNFTLYSSLRFHLPLLFTDDETVI
SIVASILPVVAVMQVFDCMSAGAHGLLRGIGKQSIGGPVNLISYYAISLPISLALSFGLG
WKLQGLWAGVSVGLFLVTTIEYTYLLKTDWKQAAREAAVRNAAG
Download sequence
Identical sequences jgi|Trias1|129379|e_gw1.2.1336.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]