SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trias1|77663|estExt_fgenesh1_pm.C_3_t20299 from Trichoderma asperellum CBS 433.97 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trias1|77663|estExt_fgenesh1_pm.C_3_t20299
Domain Number 1 Region: 394-541
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.94e-32
Family Poly(A) polymerase, PAP, N-terminal domain 0.041
Further Details:      
 
Domain Number 2 Region: 548-688
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.62e-28
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.041
Further Details:      
 
Weak hits

Sequence:  jgi|Trias1|77663|estExt_fgenesh1_pm.C_3_t20299
Domain Number - Region: 279-292,371-395
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trias1|77663|estExt_fgenesh1_pm.C_3_t20299
Sequence length 727
Sequence
MVRNKPQRRNDDRGRNGYGDDRNHHGFRRSPPRFTPSRDRSYRDSDNWRPGDGRRPDSNS
RPYSDDRRGGGADSYRPHVPQGDFTFRMDKPAGISNYVPNGQPPQRRPPRRDGRGGGPRR
PGRPRWQPPPHPSERALISGVTTGLPEESVHTGEGAKFRDLDELSDDDELDMDISSRSSL
SDTEEPSKKRVRTAVADESANAAPKWSNPDPYTALPCPDDATRKKRDVVKLIRKARLEDN
SNKPLVSTEAEDFLSFDLSDEEGENESDIKVIKASELPPPPPPPSELPPPPPPPPASVNY
NNNNNNNNNNNNIEPLGRGIHSLPNKPAAPQDRSDPLGSRKRTHDDEIIQPPNYKQFKKP
NMRPSKGTLVPNWTPKPNEEPCPWATVDHSATTNMAFRLHKEVMDFYEFVKPCDFEQTIR
NNLVENLKKAMKRDDRNFANAQLFPFGSFMSGLYLPTADMDLVVCSASFMRGGPPTYLSA
KSWLYKFRKFLVAQRIAEQESIEVIAHARIPLVKFIDRVTGLRVDVSFENLGGVKAIDTF
LRWKEEYPAMPILVTVIKHFLLMRGLNEPVNGGLGGFSVICLVVSMLQLMPQVQSRSLVP
EHHLGEMLLEFFELYGRNFDYEVNAISLTSPIGYVRKSQVSSFTYKKTDRLSIIDPNNPA
NDISGSSSNTEGVLSRFHDAYLTLRDRMQQVGNDPKCGGILDVLFKGDYSSFRMQRTFLQ
HIYEKRG
Download sequence
Identical sequences jgi|Trias1|77663|estExt_fgenesh1_pm.C_3_t20299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]