SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288817467|ref|YP_003431814.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288817467|ref|YP_003431814.1|
Domain Number 1 Region: 13-350
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.09e-47
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288817467|ref|YP_003431814.1|
Sequence length 351
Comment NirF protein [Hydrogenobacter thermophilus TK-6]
Sequence
MLLVMLFILILPFLSIAEKLYVVERERGSLAVVEEGKVVKEIEGLGNLSHATVKVWEGYA
YVISRDGYLSKIDPKEDKLLKRVKVGNSTIGLDFTDNHIVVANYDPHTVVVLDEELNILK
TLKTGSRNVGIKGFEGGFVFSLMDKDEVWVVERQEIRKFKVGNMPFDALLSGDIYLLGFF
KESGIGMIDIKNKLYRKLDFKAQGKEVVFKIPHFGTWGIVGDEAFIPAVGEKRLYKVDLR
KMEILGHVELGGLPVFASVSPNGNYLAVNFSGDREDYLALVDVKEMKVLKELKLGQRIMH
LRFSQDGTRLYVSSYFDSKLRAFQVPDLKLLYELNIPHPSGVFLIRRNHHG
Download sequence
Identical sequences D3DFL1 Q3LGA5
gi|288817467|ref|YP_003431814.1| WP_012962796.1.15338 WP_012962796.1.18459 gi|288817467|ref|YP_003431814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]