SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288817471|ref|YP_003431818.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288817471|ref|YP_003431818.1|
Domain Number 1 Region: 127-551
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.2e-109
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000000000843
Further Details:      
 
Domain Number 2 Region: 7-126
Classification Level Classification E-value
Superfamily Cytochrome c 3.76e-25
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288817471|ref|YP_003431818.1|
Sequence length 551
Comment cytochrome cd1 nitrite reductase [Hydrogenobacter thermophilus TK-6]
Sequence
MRKRKKVLIGGALVFVLFAGTYAQQQQKEELPPPPPLTKQEMERAKEIYFDRCAGCHGAL
RKGATGPALTPDKTRKLGTETLKTFITYGTPGGMPDWGRQGILTPEEVDLMARYIQHDPP
PPPELPLGEMKKSWKVYVPPEKRPQKPEHNRNWQNFMAVILRDIGKVAIIDGDTKELVST
VDTGYAVHIARYSASGRYLYTIGRDGKVVLIDLWMKKPDKVAEVKTCYDGRSLDTSKYKG
PKGDFLDKLAIIGCYWPPSFVIVDGQTLEPLKIVATSAYTYDTNEFLREARVASIVASHY
DPEWVVNVKEAGQIWLVDYSNIHAPKITMIDAERFLHDGGWDASKRYFLVAANFRDTISV
VDTKEKKLVKNIKVGTRPHPGRGANIDHPKYGPLWCTGHLGDNTIRCIGTDPVKHPQYAW
KVVVKMEMPGEGGGNLFIKTHPKSPHLWADRALNNDPKLQRSLFVFDKNTFQIKKVIEIP
PEFQGRAVHLEYNKNGDEVWVAVWSKKNEPEKQAILVYDDKTLTLKKAITGNWVATPTGH
FNVYNTMKDIY
Download sequence
Identical sequences D3DFL5
gi|288817471|ref|YP_003431818.1| gi|288817471|ref|YP_003431818.1| WP_012962800.1.15338 WP_012962800.1.18459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]