SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288818331|ref|YP_003432679.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288818331|ref|YP_003432679.1|
Domain Number 1 Region: 61-488
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.54e-16
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288818331|ref|YP_003432679.1|
Sequence length 515
Comment hypothetical protein HTH_1020 [Hydrogenobacter thermophilus TK-6]
Sequence
MCENLKGGAAMSWNRRDLFKLGILGAVVGGIGKLATGTAQALPIIGGEPTFNDVYKQIGR
YIFLVPGKFAGLVAAYDMSTGMCLAWANMSIWAGNRTPIVHHLAAFASPDPYKEFEFVVN
TQGGKNLYIYGVATPVKDPDPGFNIWRIKYDGSKMVLLEEVDKTTGLGLGVHVTAAPDNK
HFAVADGQKDIFAVFEKGEGTAPSKVKTAVFFDWEPNSKELSRAWLDGGTLIIKKLHPPY
DYTGTKGNKLDWELVPGGELFAEQGKVTGARVRNACALDSLTWNPTKPYAAAALRTIGCA
VIFDTRTWEPVACLVGSDKFAKHGYKLPIKKVSADEWEVKFPFVPTPAHQAGFHPSGNYF
VLMNNIRENSMPVFDCSSSDPGKWTKIASVGDPSWRGAYPNPFHMVFTPDGKKLFVTLWW
PAPTPNGLAAVDTDTWKIEKTITIGPDIHTLAITYDGKHLLGVFSGYQKTHSGMYVLRVK
DYKLLGYLPSPLGHHDCVIVPRTTKDLYVSRCTTT
Download sequence
Identical sequences D3DI26
WP_012963658.1.15338 WP_012963658.1.18459 gi|288818331|ref|YP_003432679.1| gi|288818331|ref|YP_003432679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]