SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|472320841|ref|YP_007670366.1| from Polaribacter sp. MED152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472320841|ref|YP_007670366.1|
Domain Number 1 Region: 9-117
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.12e-16
Family Intron-encoded homing endonucleases 0.00069
Further Details:      
 
Weak hits

Sequence:  gi|472320841|ref|YP_007670366.1|
Domain Number - Region: 138-173
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0735
Family Tetracyclin repressor-like, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|472320841|ref|YP_007670366.1|
Sequence length 183
Comment hypothetical protein MED152_01630 [Polaribacter sp. MED152]
Sequence
MIRNLYNEEWKDIQFDEKIAVNEKYQISNYGRVINCNTEVPYLRNKTFINGYETISLKQE
VNKKSTSRYVHKLVAQHFIDKENEEQRYVIHLDYDKKNNEVSNLKWATKREKELHQFNNP
TWESVVKKRSRNIGKLSEGKVKIIKRQLKNNRTRISMIAKRFGVSDMQIHRIKTGENWSH
VKI
Download sequence
Identical sequences A2U2F1
gi|472320841|ref|YP_007670366.1| WP_015480101.1.7039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]