SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|472321188|ref|YP_007670711.1| from Polaribacter sp. MED152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472321188|ref|YP_007670711.1|
Domain Number 1 Region: 97-278
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.59e-41
Family Endonuclease I 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|472321188|ref|YP_007670711.1|
Sequence length 370
Comment endonuclease I [Polaribacter sp. MED152]
Sequence
MVHLKIDKKIMKYKLFLLLILLATFGFAQAPAGYYSSATGSGYTLKTQLKNIIKNGHIDQ
GYGALYDAYETSDTDSFYENDNTVLDMYSENPSGTDPYNYTHGDRKCGNYNSENDCYNRE
HIFPQGFFNSQTPMRTDIHHVVPTDGSVNGRRSNYPFGEVTNANHTSLNGSKVGNNTVFG
YSGIVFEPIDEFKGDIARMLFYFATRYEDDVTDSSWDDPNDSANNPLNGTNNQVYAQWYI
QLLYKWHLEDPVSQREIVRNNEAYDFQGNRNPFIDHPEYVSEIWSSVLSTESFNKTSFKI
YPNPNVNGTLYINTNTEINVNIYNVLGKIVVHYKIDANTNSIDISSLPKGVYLIKCNTAS
NSITKKLIKK
Download sequence
Identical sequences A2U1E8
gi|472321188|ref|YP_007670711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]