SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|126394|fgenesh1_kg.1_#_101_#_Locus2283v1rpkm94.37 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|126394|fgenesh1_kg.1_#_101_#_Locus2283v1rpkm94.37
Domain Number 1 Region: 515-644
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.00000000000178
Family Bactericidal permeability-increasing protein, BPI 0.0084
Further Details:      
 
Weak hits

Sequence:  jgi|Aspzo1|126394|fgenesh1_kg.1_#_101_#_Locus2283v1rpkm94.37
Domain Number - Region: 301-359
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00863
Family GntR ligand-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|126394|fgenesh1_kg.1_#_101_#_Locus2283v1rpkm94.37
Sequence length 737
Sequence
MPRGDTEPLLPRYEDETSRRRQLHPKLHTYQMFRALSEGYMPSTEQAIANLRTLLALDIL
SPRNEDLSAAGRQLVRDCRLSIQLLIELLREKNGQDQIQEFLWHLARSRASLDAESVSAR
ASQASAKRDTKAAYDSFRIVGNLLLTNADFRLFVDDLTTIGRQIFSDTALSLSQASKQVS
REIKPSEQDLEAISGAGADSDKAIPSDEAIRQGGEEIAKLAGDGLARTGHDAVQSARDNL
TGGNKDALFYRLKQTVLNLRERTEYSDSVATLARLVQRYAQIYSTVAEDTISAVHEDVDV
NADLREAVRGFWAVLRQFGDAEEWSALEKQFHTVIEHANRDPEFEALMSEMGTALQRVMT
DPDFLDSEEASDKVDELRGKTKQLGSESTLRQDMDAFLEQTKRTLRTVPDDPSVSKLVDV
ARKMGTDLYAATQDQKTSLLSDLSDIFLPLLIRSVQFIPIPRLEISSPELDLLVENLILE
PGHSINFSSFLPYRVHMTTRNDIDVTKKHSKRVVTDTQTTFTVTVCGLNVSAEEFGYWLR
AHAGLLLHVKDEGIASFHLDRRGIDISLDVQIGRDRLGEIFSLRGVRVRIHKLDYTLHRS
RWSILLWLAKPFLKQLIRRVLEKQIAEQIVAAATALNRELVFARERIRAARIANPHDLAS
FIRAVLARLKPRPNPDISARVGLYPPREGVFHGVYAPGSLVKMWHDEAELAQDAIDEGDH
DGGLRRTWRNDVFDVAR
Download sequence
Identical sequences A0A1L9STI2
jgi|Aspzo1|126394|fgenesh1_kg.1_#_101_#_Locus2283v1rpkm94.37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]