SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|145641|fgenesh1_pg.16_#_325 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|145641|fgenesh1_pg.16_#_325
Domain Number 1 Region: 82-219
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.11e-18
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000245
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|145641|fgenesh1_pg.16_#_325
Sequence length 225
Sequence
MYGYPEKWLEGMTTGEGIAAELRLGIVNGHIAEGTLLTENQMAKQFNVSRSPIRDAFKLL
QQNQLIQLERMGAHVLPFGEQEKKEMYDLRLMLESFAFSRVKNQERLPIVKEMKKQLEMM
KVAVKFEDAESFTKHDFEFHETLIKASNHQYLNSFWSHLKPVMMALVLTSMRQRMQQNPQ
DFERIHHNHQVFIDAVEQYDSQILKEAFHLNFDDVGKDIEGFWLN
Download sequence
Identical sequences A0A242LW79
gi|387603788|ref|YP_005735309.1| gi|379022176|ref|YP_005298838.1| gi|384865679|ref|YP_005751038.1| WP_000274558.1.100265 WP_000274558.1.100272 WP_000274558.1.100347 WP_000274558.1.100452 WP_000274558.1.10053 WP_000274558.1.100534 WP_000274558.1.100678 WP_000274558.1.100726 WP_000274558.1.101055 WP_000274558.1.101142 WP_000274558.1.101217 WP_000274558.1.101495 WP_000274558.1.101531 WP_000274558.1.101670 WP_000274558.1.101821 WP_000274558.1.101999 WP_000274558.1.102084 WP_000274558.1.10209 WP_000274558.1.102126 WP_000274558.1.10308 WP_000274558.1.10358 WP_000274558.1.10469 WP_000274558.1.1060 WP_000274558.1.10617 WP_000274558.1.10785 WP_000274558.1.10843 WP_000274558.1.11188 WP_000274558.1.11223 WP_000274558.1.1124 WP_000274558.1.11281 WP_000274558.1.11475 WP_000274558.1.11660 WP_000274558.1.11741 WP_000274558.1.11781 WP_000274558.1.11919 WP_000274558.1.12137 WP_000274558.1.12605 WP_000274558.1.12705 WP_000274558.1.12707 WP_000274558.1.12802 WP_000274558.1.12951 WP_000274558.1.13112 WP_000274558.1.13170 WP_000274558.1.13366 WP_000274558.1.13376 WP_000274558.1.13728 WP_000274558.1.13769 WP_000274558.1.13870 WP_000274558.1.13884 WP_000274558.1.13948 WP_000274558.1.1418 WP_000274558.1.14298 WP_000274558.1.14337 WP_000274558.1.14349 WP_000274558.1.14363 WP_000274558.1.14665 WP_000274558.1.14681 WP_000274558.1.14747 WP_000274558.1.14770 WP_000274558.1.15071 WP_000274558.1.15150 WP_000274558.1.15206 WP_000274558.1.15532 WP_000274558.1.15591 WP_000274558.1.15679 WP_000274558.1.15819 WP_000274558.1.15888 WP_000274558.1.15948 WP_000274558.1.16157 WP_000274558.1.16399 WP_000274558.1.16436 WP_000274558.1.16478 WP_000274558.1.17009 WP_000274558.1.17143 WP_000274558.1.17176 WP_000274558.1.17201 WP_000274558.1.17569 WP_000274558.1.17928 WP_000274558.1.17974 WP_000274558.1.18043 WP_000274558.1.18495 WP_000274558.1.18656 WP_000274558.1.18719 WP_000274558.1.18963 WP_000274558.1.19014 WP_000274558.1.19102 WP_000274558.1.19109 WP_000274558.1.1921 WP_000274558.1.19306 WP_000274558.1.19375 WP_000274558.1.19377 WP_000274558.1.1943 WP_000274558.1.1962 WP_000274558.1.19700 WP_000274558.1.19759 WP_000274558.1.19881 WP_000274558.1.20558 WP_000274558.1.20979 WP_000274558.1.21064 WP_000274558.1.21102 WP_000274558.1.21894 WP_000274558.1.21954 WP_000274558.1.22022 WP_000274558.1.22093 WP_000274558.1.2211 WP_000274558.1.22200 WP_000274558.1.22259 WP_000274558.1.22418 WP_000274558.1.22727 WP_000274558.1.22739 WP_000274558.1.22975 WP_000274558.1.23069 WP_000274558.1.23217 WP_000274558.1.23516 WP_000274558.1.23568 WP_000274558.1.2382 WP_000274558.1.23856 WP_000274558.1.23896 WP_000274558.1.2420 WP_000274558.1.24275 WP_000274558.1.24436 WP_000274558.1.24439 WP_000274558.1.25029 WP_000274558.1.2522 WP_000274558.1.257 WP_000274558.1.25776 WP_000274558.1.25852 WP_000274558.1.25984 WP_000274558.1.26033 WP_000274558.1.26172 WP_000274558.1.2619 WP_000274558.1.26289 WP_000274558.1.26397 WP_000274558.1.2645 WP_000274558.1.26584 WP_000274558.1.26749 WP_000274558.1.26850 WP_000274558.1.2687 WP_000274558.1.26929 WP_000274558.1.26963 WP_000274558.1.2697 WP_000274558.1.27080 WP_000274558.1.27168 WP_000274558.1.27467 WP_000274558.1.27696 WP_000274558.1.27799 WP_000274558.1.27929 WP_000274558.1.28079 WP_000274558.1.28447 WP_000274558.1.28482 WP_000274558.1.28564 WP_000274558.1.28584 WP_000274558.1.28614 WP_000274558.1.2862 WP_000274558.1.2891 WP_000274558.1.2913 WP_000274558.1.29244 WP_000274558.1.29301 WP_000274558.1.29731 WP_000274558.1.2983 WP_000274558.1.2997 WP_000274558.1.29982 WP_000274558.1.30130 WP_000274558.1.30191 WP_000274558.1.30385 WP_000274558.1.30566 WP_000274558.1.30568 WP_000274558.1.30648 WP_000274558.1.30650 WP_000274558.1.30652 WP_000274558.1.30880 WP_000274558.1.30907 WP_000274558.1.30928 WP_000274558.1.31041 WP_000274558.1.31065 WP_000274558.1.31077 WP_000274558.1.31113 WP_000274558.1.31278 WP_000274558.1.31441 WP_000274558.1.31497 WP_000274558.1.31568 WP_000274558.1.31589 WP_000274558.1.31605 WP_000274558.1.31743 WP_000274558.1.3188 WP_000274558.1.32077 WP_000274558.1.3231 WP_000274558.1.32599 WP_000274558.1.32761 WP_000274558.1.32763 WP_000274558.1.32829 WP_000274558.1.33029 WP_000274558.1.3330 WP_000274558.1.33322 WP_000274558.1.33328 WP_000274558.1.3343 WP_000274558.1.33538 WP_000274558.1.33567 WP_000274558.1.33607 WP_000274558.1.33655 WP_000274558.1.33707 WP_000274558.1.33767 WP_000274558.1.33850 WP_000274558.1.33989 WP_000274558.1.34060 WP_000274558.1.34078 WP_000274558.1.34254 WP_000274558.1.34427 WP_000274558.1.34473 WP_000274558.1.34733 WP_000274558.1.34774 WP_000274558.1.34912 WP_000274558.1.34943 WP_000274558.1.35054 WP_000274558.1.35182 WP_000274558.1.35194 WP_000274558.1.35423 WP_000274558.1.3549 WP_000274558.1.35506 WP_000274558.1.35730 WP_000274558.1.3574 WP_000274558.1.35742 WP_000274558.1.35958 WP_000274558.1.36041 WP_000274558.1.3611 WP_000274558.1.36698 WP_000274558.1.36754 WP_000274558.1.36797 WP_000274558.1.3690 WP_000274558.1.36916 WP_000274558.1.36962 WP_000274558.1.37045 WP_000274558.1.37091 WP_000274558.1.3718 WP_000274558.1.3719 WP_000274558.1.37453 WP_000274558.1.37866 WP_000274558.1.37875 WP_000274558.1.37891 WP_000274558.1.38020 WP_000274558.1.38034 WP_000274558.1.3813 WP_000274558.1.3817 WP_000274558.1.38557 WP_000274558.1.38786 WP_000274558.1.38943 WP_000274558.1.38979 WP_000274558.1.38985 WP_000274558.1.3908 WP_000274558.1.39241 WP_000274558.1.39285 WP_000274558.1.39378 WP_000274558.1.39519 WP_000274558.1.39613 WP_000274558.1.40161 WP_000274558.1.40383 WP_000274558.1.40401 WP_000274558.1.40554 WP_000274558.1.40748 WP_000274558.1.40800 WP_000274558.1.41011 WP_000274558.1.4102 WP_000274558.1.41058 WP_000274558.1.41104 WP_000274558.1.41122 WP_000274558.1.41133 WP_000274558.1.4144 WP_000274558.1.41473 WP_000274558.1.41532 WP_000274558.1.41533 WP_000274558.1.41817 WP_000274558.1.41891 WP_000274558.1.42001 WP_000274558.1.42460 WP_000274558.1.42551 WP_000274558.1.42738 WP_000274558.1.42740 WP_000274558.1.42819 WP_000274558.1.42848 WP_000274558.1.43020 WP_000274558.1.43114 WP_000274558.1.43200 WP_000274558.1.43206 WP_000274558.1.43506 WP_000274558.1.43988 WP_000274558.1.44186 WP_000274558.1.44331 WP_000274558.1.44536 WP_000274558.1.4499 WP_000274558.1.45008 WP_000274558.1.45114 WP_000274558.1.45221 WP_000274558.1.45878 WP_000274558.1.46013 WP_000274558.1.46109 WP_000274558.1.46965 WP_000274558.1.47276 WP_000274558.1.47719 WP_000274558.1.47989 WP_000274558.1.48425 WP_000274558.1.48775 WP_000274558.1.48818 WP_000274558.1.48966 WP_000274558.1.49154 WP_000274558.1.49173 WP_000274558.1.49234 WP_000274558.1.49330 WP_000274558.1.49704 WP_000274558.1.49715 WP_000274558.1.49913 WP_000274558.1.49936 WP_000274558.1.50015 WP_000274558.1.50229 WP_000274558.1.50360 WP_000274558.1.50431 WP_000274558.1.50516 WP_000274558.1.50669 WP_000274558.1.50759 WP_000274558.1.50827 WP_000274558.1.51008 WP_000274558.1.51062 WP_000274558.1.51085 WP_000274558.1.51138 WP_000274558.1.51787 WP_000274558.1.51812 WP_000274558.1.5190 WP_000274558.1.51920 WP_000274558.1.52162 WP_000274558.1.52252 WP_000274558.1.52259 WP_000274558.1.52536 WP_000274558.1.52772 WP_000274558.1.52820 WP_000274558.1.52838 WP_000274558.1.52904 WP_000274558.1.53007 WP_000274558.1.53077 WP_000274558.1.53661 WP_000274558.1.53682 WP_000274558.1.53712 WP_000274558.1.53714 WP_000274558.1.53763 WP_000274558.1.53786 WP_000274558.1.54135 WP_000274558.1.54269 WP_000274558.1.54477 WP_000274558.1.54847 WP_000274558.1.54914 WP_000274558.1.55090 WP_000274558.1.55352 WP_000274558.1.55620 WP_000274558.1.5565 WP_000274558.1.5575 WP_000274558.1.55839 WP_000274558.1.55848 WP_000274558.1.55859 WP_000274558.1.56099 WP_000274558.1.56210 WP_000274558.1.56213 WP_000274558.1.56241 WP_000274558.1.56260 WP_000274558.1.56272 WP_000274558.1.56275 WP_000274558.1.56364 WP_000274558.1.56522 WP_000274558.1.56525 WP_000274558.1.56679 WP_000274558.1.57158 WP_000274558.1.57271 WP_000274558.1.57291 WP_000274558.1.5735 WP_000274558.1.57385 WP_000274558.1.5743 WP_000274558.1.57612 WP_000274558.1.57635 WP_000274558.1.57928 WP_000274558.1.58139 WP_000274558.1.5827 WP_000274558.1.58584 WP_000274558.1.58588 WP_000274558.1.58860 WP_000274558.1.59178 WP_000274558.1.59334 WP_000274558.1.59414 WP_000274558.1.59594 WP_000274558.1.59864 WP_000274558.1.60118 WP_000274558.1.60158 WP_000274558.1.60339 WP_000274558.1.60355 WP_000274558.1.60719 WP_000274558.1.60730 WP_000274558.1.60859 WP_000274558.1.60934 WP_000274558.1.61019 WP_000274558.1.61318 WP_000274558.1.61346 WP_000274558.1.6149 WP_000274558.1.61515 WP_000274558.1.61653 WP_000274558.1.61709 WP_000274558.1.61713 WP_000274558.1.61776 WP_000274558.1.61843 WP_000274558.1.6188 WP_000274558.1.61962 WP_000274558.1.61976 WP_000274558.1.62127 WP_000274558.1.62392 WP_000274558.1.62462 WP_000274558.1.62563 WP_000274558.1.6266 WP_000274558.1.62925 WP_000274558.1.63021 WP_000274558.1.63107 WP_000274558.1.63255 WP_000274558.1.63288 WP_000274558.1.63540 WP_000274558.1.6355 WP_000274558.1.63672 WP_000274558.1.63704 WP_000274558.1.63763 WP_000274558.1.63890 WP_000274558.1.63998 WP_000274558.1.64060 WP_000274558.1.64181 WP_000274558.1.64232 WP_000274558.1.64408 WP_000274558.1.64434 WP_000274558.1.64446 WP_000274558.1.645 WP_000274558.1.6453 WP_000274558.1.64537 WP_000274558.1.64911 WP_000274558.1.6509 WP_000274558.1.65164 WP_000274558.1.65274 WP_000274558.1.65599 WP_000274558.1.65704 WP_000274558.1.6578 WP_000274558.1.65928 WP_000274558.1.65990 WP_000274558.1.66014 WP_000274558.1.66227 WP_000274558.1.66328 WP_000274558.1.66518 WP_000274558.1.66645 WP_000274558.1.6668 WP_000274558.1.66690 WP_000274558.1.66792 WP_000274558.1.66853 WP_000274558.1.66904 WP_000274558.1.66906 WP_000274558.1.67016 WP_000274558.1.67152 WP_000274558.1.67375 WP_000274558.1.67620 WP_000274558.1.67798 WP_000274558.1.67800 WP_000274558.1.67808 WP_000274558.1.67931 WP_000274558.1.68020 WP_000274558.1.68233 WP_000274558.1.68334 WP_000274558.1.68392 WP_000274558.1.68747 WP_000274558.1.68773 WP_000274558.1.68931 WP_000274558.1.69016 WP_000274558.1.69162 WP_000274558.1.69412 WP_000274558.1.69483 WP_000274558.1.69489 WP_000274558.1.69520 WP_000274558.1.69639 WP_000274558.1.69721 WP_000274558.1.70266 WP_000274558.1.70457 WP_000274558.1.70541 WP_000274558.1.70672 WP_000274558.1.70850 WP_000274558.1.70994 WP_000274558.1.71027 WP_000274558.1.71179 WP_000274558.1.71266 WP_000274558.1.71280 WP_000274558.1.71301 WP_000274558.1.71404 WP_000274558.1.71428 WP_000274558.1.71438 WP_000274558.1.71483 WP_000274558.1.71541 WP_000274558.1.71547 WP_000274558.1.71771 WP_000274558.1.71800 WP_000274558.1.71828 WP_000274558.1.71836 WP_000274558.1.71981 WP_000274558.1.72257 WP_000274558.1.72489 WP_000274558.1.72529 WP_000274558.1.72760 WP_000274558.1.72874 WP_000274558.1.7294 WP_000274558.1.73489 WP_000274558.1.73536 WP_000274558.1.73547 WP_000274558.1.73687 WP_000274558.1.73837 WP_000274558.1.74025 WP_000274558.1.74985 WP_000274558.1.75127 WP_000274558.1.75521 WP_000274558.1.75590 WP_000274558.1.75704 WP_000274558.1.75805 WP_000274558.1.75944 WP_000274558.1.76104 WP_000274558.1.76123 WP_000274558.1.76659 WP_000274558.1.76689 WP_000274558.1.76869 WP_000274558.1.76895 WP_000274558.1.77144 WP_000274558.1.77583 WP_000274558.1.77860 WP_000274558.1.77883 WP_000274558.1.78324 WP_000274558.1.78638 WP_000274558.1.78978 WP_000274558.1.79059 WP_000274558.1.79156 WP_000274558.1.79400 WP_000274558.1.79452 WP_000274558.1.79737 WP_000274558.1.79854 WP_000274558.1.80152 WP_000274558.1.80181 WP_000274558.1.80286 WP_000274558.1.8030 WP_000274558.1.80317 WP_000274558.1.80393 WP_000274558.1.80647 WP_000274558.1.80762 WP_000274558.1.8077 WP_000274558.1.80845 WP_000274558.1.80972 WP_000274558.1.81224 WP_000274558.1.81243 WP_000274558.1.81387 WP_000274558.1.81532 WP_000274558.1.81738 WP_000274558.1.81789 WP_000274558.1.81829 WP_000274558.1.81982 WP_000274558.1.82017 WP_000274558.1.82234 WP_000274558.1.82315 WP_000274558.1.82455 WP_000274558.1.8261 WP_000274558.1.82664 WP_000274558.1.8288 WP_000274558.1.8302 WP_000274558.1.83021 WP_000274558.1.8319 WP_000274558.1.83249 WP_000274558.1.83250 WP_000274558.1.83597 WP_000274558.1.83792 WP_000274558.1.83816 WP_000274558.1.84194 WP_000274558.1.8432 WP_000274558.1.84673 WP_000274558.1.84679 WP_000274558.1.84714 WP_000274558.1.84736 WP_000274558.1.84874 WP_000274558.1.84951 WP_000274558.1.85133 WP_000274558.1.85198 WP_000274558.1.85265 WP_000274558.1.85331 WP_000274558.1.85354 WP_000274558.1.85391 WP_000274558.1.85401 WP_000274558.1.85425 WP_000274558.1.85549 WP_000274558.1.85562 WP_000274558.1.85634 WP_000274558.1.86136 WP_000274558.1.86153 WP_000274558.1.86197 WP_000274558.1.86331 WP_000274558.1.8641 WP_000274558.1.86455 WP_000274558.1.8663 WP_000274558.1.86916 WP_000274558.1.87236 WP_000274558.1.87534 WP_000274558.1.87593 WP_000274558.1.87636 WP_000274558.1.87682 WP_000274558.1.8770 WP_000274558.1.88212 WP_000274558.1.88339 WP_000274558.1.88445 WP_000274558.1.88504 WP_000274558.1.88572 WP_000274558.1.88638 WP_000274558.1.8877 WP_000274558.1.88881 WP_000274558.1.89027 WP_000274558.1.89108 WP_000274558.1.89139 WP_000274558.1.89216 WP_000274558.1.89372 WP_000274558.1.89476 WP_000274558.1.8950 WP_000274558.1.89556 WP_000274558.1.89557 WP_000274558.1.89603 WP_000274558.1.89686 WP_000274558.1.89799 WP_000274558.1.89924 WP_000274558.1.90095 WP_000274558.1.90145 WP_000274558.1.90345 WP_000274558.1.90370 WP_000274558.1.90740 WP_000274558.1.90757 WP_000274558.1.90818 WP_000274558.1.90820 WP_000274558.1.91297 WP_000274558.1.9153 WP_000274558.1.91624 WP_000274558.1.91660 WP_000274558.1.91746 WP_000274558.1.91909 WP_000274558.1.91919 WP_000274558.1.92147 WP_000274558.1.9237 WP_000274558.1.92546 WP_000274558.1.92688 WP_000274558.1.93198 WP_000274558.1.93263 WP_000274558.1.9330 WP_000274558.1.93374 WP_000274558.1.93538 WP_000274558.1.93647 WP_000274558.1.93669 WP_000274558.1.93975 WP_000274558.1.94093 WP_000274558.1.94182 WP_000274558.1.94229 WP_000274558.1.94407 WP_000274558.1.94625 WP_000274558.1.94719 WP_000274558.1.94838 WP_000274558.1.95002 WP_000274558.1.95442 WP_000274558.1.95535 WP_000274558.1.95552 WP_000274558.1.95631 WP_000274558.1.95640 WP_000274558.1.96105 WP_000274558.1.96364 WP_000274558.1.96424 WP_000274558.1.96477 WP_000274558.1.96489 WP_000274558.1.96578 WP_000274558.1.96637 WP_000274558.1.96638 WP_000274558.1.96718 WP_000274558.1.96956 WP_000274558.1.97033 WP_000274558.1.97146 WP_000274558.1.97302 WP_000274558.1.97409 WP_000274558.1.97460 WP_000274558.1.9748 WP_000274558.1.97575 WP_000274558.1.9758 WP_000274558.1.97641 WP_000274558.1.97742 WP_000274558.1.97953 WP_000274558.1.98548 WP_000274558.1.98559 WP_000274558.1.98710 WP_000274558.1.98805 WP_000274558.1.98807 WP_000274558.1.98912 WP_000274558.1.98981 WP_000274558.1.99027 WP_000274558.1.99081 WP_000274558.1.991 WP_000274558.1.99174 WP_000274558.1.99228 WP_000274558.1.99331 WP_000274558.1.9974 jgi|Aspzo1|145641|fgenesh1_pg.16_#_325 gi|385782725|ref|YP_005758896.1| gi|521213253|ref|YP_008169599.1| gi|545638716|ref|YP_008588892.1| gi|404479817|ref|YP_006711247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]