SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404215537|ref|YP_006669732.1| from Gordonia sp. KTR9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404215537|ref|YP_006669732.1|
Domain Number 1 Region: 9-264
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.1e-78
Family Tryptophan biosynthesis enzymes 0.00000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404215537|ref|YP_006669732.1|
Sequence length 269
Comment indoleglycerol phosphate aldolase [Gordonia sp. KTR9]
Sequence
MSTQSIPSKLGPVFARCREEGRSALIGYLPVGFPTVEESLTSFRTMVDAGCDIIEVGVPY
SDPVMDGPTIQDAADLALTNGVRVRDVFTAVEAITSAGGNAVVMSYWNPVLKYGVENFAR
DLAEAGGAGLITPNLIPEEGAQWHEAADRHGLDRIYLVAPSSTAERIALTVDASRGFVYA
ASTMGVTGARDAVSDMAPELCARVREYSDIPIGVGLGVRNREQAAQIASYADGVIVGSAL
VTAANAGQDRLASLVSELAEGVRSRRASV
Download sequence
Identical sequences J9S5C3
WP_014927243.1.60447 gi|404215537|ref|YP_006669732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]