SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357388365|ref|YP_004903204.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|357388365|ref|YP_004903204.1|
Domain Number - Region: 76-108,330-356
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0136
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357388365|ref|YP_004903204.1|
Sequence length 397
Comment hypothetical protein KSE_14200 [Kitasatospora setae KM-6054]
Sequence
MTDPYSAPGLTPGHLGAPVVEPEGAPPGLPYGVEPPDPEQVRTRAACCLSVAGLLGVALS
AALALVVLWPEGRQPAADYAGGGSGQVQVSVPQGASLTQIGKVLTAKHVVASTRAFTDAA
AKSPAGNQIHPGTYTLKEKMSAASALNVLLDPSNANALTIPEGWRSSQVFGAIDTRLGLA
AGTAKTTAEQHLADLGLPADAAGHLEGYLYPATYPVTGDSTPLTLLKDMVKEAGGILDDP
SVAEAAAANGVSPYGLLAVASLAQAEADNPEDMAKVARVVYNRLAKNMPLQLDSTINYAL
GRSTLTTTHDDTRLDSPFNTYAHPGLPPTPIGNPGRDALRAAVHPADGDWLYFVTVQPGD
TRFTDSDEQQRKNVEEFNAYRAQHAPTAPSGPATPSP
Download sequence
Identical sequences E4N7R7
gi|357388365|ref|YP_004903204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]