SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357388675|ref|YP_004903514.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357388675|ref|YP_004903514.1|
Domain Number 1 Region: 17-90
Classification Level Classification E-value
Superfamily Homeodomain-like 6.67e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|357388675|ref|YP_004903514.1|
Domain Number - Region: 98-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0445
Family Tetracyclin repressor-like, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357388675|ref|YP_004903514.1|
Sequence length 254
Comment putative TetR family transcriptional regulator [Kitasatospora setae KM-6054]
Sequence
MASRTPSATPRAAERAPRRRLSVDERREQLIAVALQLFSDRAPEDVSIDDIAAAAGASRP
LVYHYFPGKQALYEEALRRAGRELAGRFEEPGEGPLSERLLRVMGRYLDFVESHAAGFTA
LLRGGSVTASPDADAVIDQVRRAAQQQILLHLGVPDPSPSLRRTVRAWIANAEISSLDWL
ADKPVPVETLQLQLVQELVAALAVAATRDPELAALLGGFFATEEPDGPTALLLRDLLATF
TAPELAAPLLRLTR
Download sequence
Identical sequences E4N8M7
WP_014134876.1.24815 WP_014134876.1.28511 gi|357388675|ref|YP_004903514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]