SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357389270|ref|YP_004904109.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357389270|ref|YP_004904109.1|
Domain Number 1 Region: 211-538
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.96e-86
Family Thermolysin-like 0.000000415
Further Details:      
 
Domain Number 2 Region: 546-629
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000251
Family Cadherin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357389270|ref|YP_004904109.1|
Sequence length 784
Comment putative zinc metallopeptidase [Kitasatospora setae KM-6054]
Sequence
MSRRTHARVSMAALAATTALLVTAIPATLAQAAPAGAPAPSGQVAAEQAAAGHAQLISAA
DTRAAGFAQGLGLGATEKLVAKDAFKDADGTQHFRYERTYGGLPVLGGDLIVHQAANGTT
KGVDRASTATLDGLSTTPKLAAAKGQAAALAAQAGSALETAPRLVVWAADNNPRLAWETV
VSGAQEDGTPSKLHVLTDATSGAVIQKWEGVQTGTGNGVFVGSVTLGTSQSGSNYQLKDP
TRGNMYTTNLNNGTSGTGTLYSKTTDSWGDGTVSNKESAAVDAHYGVAATWDYYKNTFGR
SGIRNDGVGAYSRVHYGSNYVNAFWDDSCFCMTYGDGSGNTHPLTELDVAGHEMTHGVTS
NTAGLNYSGESGGLNESTSDVFGTLVEFYANLPKDNPDYLIGELIDINGNGTPLRYLDKP
SKDGSSADSWYSGVGNLDVHYSSGVGNHFFYLLSEGSGAKVINGVSYNSPTANSITVTGI
GRDKAAAIWYRALTTYWTSTTNYASARAGTLSAATDLYGAGSAEYNATATAWAAVNVGSL
PSTGGPTVTSPGNQSTALNGAASLQIQASGGTAPLGYTATGLPTGLSINASTGLISGTAT
AAGTYNVTVTAKDAANKTGTASFTWTVTSGGGTGCTPAQLLGNPGFETGTASPWTASAGV
VDNSSGQAAHGGTWKAWLDGYGSAHTDSLSQTVTIPAGCKATLSYWLHIDTAETGSTVYD
KLTVTVNGTTVATHSNVNAATGYTQKSVDLSAYAGQSVTVKFNAVEDASLQTSFVIDDTA
VQTS
Download sequence
Identical sequences E4NAC2
gi|357389270|ref|YP_004904109.1| WP_014135469.1.28511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]