SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357392608|ref|YP_004907449.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357392608|ref|YP_004907449.1|
Domain Number 1 Region: 79-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000144
Family NfeD domain-like 0.011
Further Details:      
 
Weak hits

Sequence:  gi|357392608|ref|YP_004907449.1|
Domain Number - Region: 5-59
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 0.00183
Family Inosine monophosphate dehydrogenase (IMPDH) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357392608|ref|YP_004907449.1|
Sequence length 144
Comment hypothetical protein KSE_57200 [Kitasatospora setae KM-6054]
Sequence
MEPVDSWIWWLLLAVALGIPLVVTAMPEFAMFAIGAGAAALTAGLGGGTVPQFLVFVGVS
AALLVFVRPIAYRQLKKGPGYRTGVEALTGATAVVQETVDGGEGGRIKLNGEIWSARALH
PGSVFEPGQQVDVVEIQGATALVV
Download sequence
Identical sequences E4N3L2
WP_014138790.1.24815 WP_014138790.1.28511 gi|357392608|ref|YP_004907449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]