SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357393514|ref|YP_004908355.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357393514|ref|YP_004908355.1|
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 2.48e-86
Family Cgl1923-like 0.0000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357393514|ref|YP_004908355.1|
Sequence length 303
Comment hypothetical protein KSE_66400 [Kitasatospora setae KM-6054]
Sequence
MIELEDLPELIDPVMICAFEGWNDAGDAASAALGHLDETWGGKVFAALDAEDYYDFQVNR
PTIWLDGGVRRITWPTTRLSVVRVTDPKPRDLVLVRGIEPSMRWRSYCNELLGFAHELGV
ELVVILGALLGDTPHTRPVPVSGVTSDPTVARSLDLEESRYEGPTGIVGVLQEACAHAGV
PAVTFWAAVPHYVSQPPNPKATLALINKVEDLLDLRIPPGELADDARAWQVGVDQLAAED
SEVAEYVQQLEEAQDTAELPEASGDAIAREFERYLRRRDNQGPKGEKPITGHATERPKDD
DEE
Download sequence
Identical sequences E4N2L5
gi|357393514|ref|YP_004908355.1| WP_014139695.1.24815 WP_014139695.1.28511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]