SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357389455|ref|YP_004904294.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357389455|ref|YP_004904294.1|
Domain Number 1 Region: 29-275
Classification Level Classification E-value
Superfamily Cgl1923-like 2.75e-72
Family Cgl1923-like 0.00000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357389455|ref|YP_004904294.1|
Sequence length 313
Comment hypothetical protein KSE_25250 [Kitasatospora setae KM-6054]
Sequence
MRDPKELYELEPQGVTALAAARAAAEAGTGLVLLYHFEGFMDAGEAGGQVVAHLLEQGTP
QVVARFDHDRLVDYRARRPAMTFDRESWTDYDPPEILLQLARDAVGAPFLVLTGPEPDTE
WELFAAAIADLVERFEIRLALSFHGIPMGVPHTRPVGLTPHGNRIDLAPGHPKWFDQAQV
PGSAQALVEFRLLEAGHDVLGFAAHVPHYIARSSYPAAAVAILEAAQSATGLVLPGSELR
ARVNEVYAEIEDQLSQGDGELRAAIQGMEGQYDAVSGVVDRESLLAEANDLPSADELGRR
FEEFLAEHERGAE
Download sequence
Identical sequences E4NAV7
WP_014135652.1.24815 WP_014135652.1.28511 gi|357389455|ref|YP_004904294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]