SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357393893|ref|YP_004908734.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357393893|ref|YP_004908734.1|
Domain Number 1 Region: 75-528
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.61e-160
Family Cellulases catalytic domain 0.00000000000279
Further Details:      
 
Domain Number 2 Region: 536-682
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.93e-36
Family Cellulose-binding domain family III 0.00000972
Further Details:      
 
Domain Number 3 Region: 737-837
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.84e-31
Family Cellulose-binding domain family II 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357393893|ref|YP_004908734.1|
Sequence length 840
Comment putative endoglucanase precursor [Kitasatospora setae KM-6054]
Sequence
MPHAAAPPPGPSRPERPRRRTAAPARPVGGTRRAVLGLLAAGVLAAAALLPLHAGTAAAA
AAVEPAEPAAVAPAFDYGEALQKSLLFYEAQQSGKLPATNRVSWRGDSALDDGKDVGLDL
TGGWYDAGDHVKFGLPMAASTTMLAWGGIAEKQAYTASGQLPYLKNNLRFVDDYLIKAHP
APNVLYGQVGSGSADHAWWGPAEVLPMARPAYRIDASCPGSDLAGETAAALASSSMVFAD
SDPAYAATLLTHAKQLYSFADTYRGKYSDCIKDAQGYYNSWSGYNDELVWGAIWLYRATG
DSAYLAKAESYYANLSTEPQSTTKSYKWTIAWDDKSYGAYVLLAQLTGKQQYVDDANRWL
DWWTVGVNGSQVRYSPGGEAVLDSWGSLRYAANTSFVALVYSDTLAGDPVRKARYHDFAV
RQIGYALGDNPRKSSYLIGFGANSPKNPHHRTAHGSWTDQLTNPVDSRHTLIGALVGGPS
SADDAYTDDRSNYVNNEVATDYNAAFTGALARLYGEYGGSPLAAFPPRETPDGPEMSVQA
SVNAAGTNFTEIKAYLIDKSAWPARPLKNAALRYYFTLEPGVSPSQITLTTNYNQCGAVS
GPTLYAGSTYYVTVDCSNTVIAPAGQSAYRKEVQFRIASAGAWDPTNDWSYQGISLVPGS
TPVDAANIRLLDGGVPQWGAEPGGSPSSSPSPSASASASPSQSPSPSPSPSVSPSPSPSP
SPSSSSSGSGSPSQPVAGCTVAYVVGSNWGTGFTADVTVRNTGGTTVSGWTLAWTYRGGE
AVTNAWNAKVVQSGAAVTAADAGWNGTLAPGGTASFGFQASGSPAALPAFTLNGRACAAA
Download sequence
Identical sequences E4MYU5
WP_014140069.1.24815 WP_014140069.1.28511 gi|357393893|ref|YP_004908734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]