SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428210379|ref|YP_007094732.1| from Chroococcidiopsis thermalis PCC 7203

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428210379|ref|YP_007094732.1|
Domain Number 1 Region: 1720-1968
Classification Level Classification E-value
Superfamily EAL domain-like 3.53e-87
Family EAL domain 0.0015
Further Details:      
 
Domain Number 2 Region: 4-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.9e-49
Family Protein kinases, catalytic subunit 0.0000835
Further Details:      
 
Domain Number 3 Region: 1548-1706
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.1e-46
Family GGDEF domain 0.00032
Further Details:      
 
Domain Number 4 Region: 1338-1510
Classification Level Classification E-value
Superfamily GAF domain-like 8.29e-27
Family GAF domain 0.0065
Further Details:      
 
Domain Number 5 Region: 297-593
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-19
Family Extended AAA-ATPase domain 0.067
Further Details:      
 
Weak hits

Sequence:  gi|428210379|ref|YP_007094732.1|
Domain Number - Region: 811-880,1221-1284
Classification Level Classification E-value
Superfamily TPR-like 0.0806
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428210379|ref|YP_007094732.1|
Sequence length 1969
Comment GAF sensor-containing diguanylate cyclase/phosphodiesterase [Chroococcidiopsis thermalis PCC 7203]
Sequence
MSTIAISSYEIINKIYESDRSVVYRAWRIRDRQPIILKILKAEQPSLEELIRYKQEYEIT
HSLNLSGVVKAYSLENFQNTVLITLEDFGGESLEILSKAKKIGLKNFLEIAILIVESLCQ
IHAANIIHKDISPANIVFNSATKQLKITDFGVATVLSKETPNFSHPSILEGTLNYISPEQ
TGRMNRNVDYRTDFYSLGATFYQLLTHQLPFDTDDPLELIHCHLAKQPIPPHQIDPSIPL
ALSKIVIKLLAKTAEARYQSAWGIRADLKNCWQQLENNHTVTEFELGKEDVSDKLQIPQK
LYGREREIKILLAAFGRVCEEGQRRQGGQEIPITNYQFKPELVLVRGYAGIGKSSLVQET
FKLVTQKKGYFVQGKYEQYQRHIPYFGLIKALQELVRQLLLEDSDRLAKWRDCILTTCGE
NIGVLIDVVPDLSLLLGQHSAIATLNSTTAEHRFKLVFQKLIQVFAQAEHPLIIFLDDLQ
WVDRATLQLIQILVAEGKQYLFLIGAYRDNEVNVFHPLSLSLEELTKFGVTIHYISLTPL
NISQINQLLLETLKCDREVTEPLAKLILETTRGNPFFISEFIAYLEAEDLLKFERARQIW
YWNLTEIQLAQATHNNLTELLVKKIQKLDNNTQQILKLAACIGSSFELSTLVGCMTKPAE
VIVALLQPAIAASLIIPIGNDRTAIELGISPTRILTVRYKFAHDRIQQAAYSSIPEGTKQ
TLHQIVGRTLLQNTLADKQEEKIFDIVNHLNFSISLLQNQTEKDELAALNLTAAKKAKES
IAYESALSYASLGIKLIEEKSWQRQYELSLALFLEAAAAAYLCGKFTSTENYTDIVLQQA
KNLLDKVKVYEIKILAHVAQGKPLAAVSIAIYALRLLGVNLPHRASKFKILLAAIATKFS
LCHKHIEALINLPSMSNPHTLAAMKIMGIAGSPTYNAAPQFAPLLAFAGVNLSLKYGNTA
MSAYGYASYGVMLCGILGNIDAGYQFGKLALDLLEKFQAKELKARTFMVFNNFIRHWKEH
VREGLPSLIEAYQSGLDTGDIEFAAYCGFIYCYHSYFVGKELTALAQEMETYLQASDRLK
QETASHLLQLYRQSVANLLETTENPCFFRGKYYDEKKMLSLLLAVNHKTALFHLYCQKLV
LNYLFEAYERAAENALQAKKYTDGVIASLSLPIFNFYHSLTLISTYSSTSIWQKKRILKL
VKMNQRQMQKWANSAPMNYLHKYYLVEAERNRVLGNCNQAIDNYDRAITLAQKNAYLQEE
ALANELAAKFYLELGKDTIARIHLLNARSCYLVWGAIAKVKALDTKYARLLFTLANQSHK
FTASHNINIHTSDRLLDLNTFIKAAQIVSGEIVFQDLIHKIMQTAIENAGAELGFLLLIR
DQKLVIEAAISVASSEQTLSFPMAVTSDLLPISLINYVAEHKLDVVLQNTIDSYNFARDP
YVQSHKPKSVLCAPILNQNQLVGIFYLENNLATGAFTSDRLEILRLLCSQAAISLKNAQL
YQDLQRSELKEREKASQLEKSLKELQIAQDRLVQVQEQLLHDAFHDPLTDLPNRAWLIER
LEQAIEMHKRYPDYLYALLFIDLDRFKVVNDSLGHLVGDELIKSVASRLKLTLRASDTVA
RLGGDEFVILLENIRDLEEATVVADRIQARLKQPYRLLEYEVFTSASIGITFSTMNYERA
SDVLRDADAAMYHAKEQHKGRYQIFAPAMQARAIARLQLESDLRRAIAQQELSLHYQPII
QLSSGCLTGFEALIRWYHPQQGWIAPTEFIPVAEETGLIDSLGWWVLQQACLQLQTWRER
FPKYHSLAVNVNLSVQQLKQADAAERIEQILQTTQLPGECLKLEITESCLLETADLAPQL
LERLQALGVQLCIDDFGTGYSSLSRLHDLPIDTLKIDRSFVNHLESSRHTEIVQTIVTLA
RSLGIDAVAEGIETQLQLEKLQQLGCDLGQGYLFSQPVDSQKAEKWLNK
Download sequence
Identical sequences K9U8C2
gi|428210379|ref|YP_007094732.1| WP_015157400.1.72800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]