SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|241200|CE162438_2040 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|241200|CE162438_2040
Domain Number 1 Region: 20-275
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.02e-78
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.000000103
Further Details:      
 
Domain Number 2 Region: 366-526
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.78e-51
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.000000743
Further Details:      
 
Domain Number 3 Region: 277-359
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000102
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|241200|CE162438_2040
Sequence length 538
Sequence
MMLHLFLLSVCVFASSVFAAFGFTKSGNNYVIDAGSSNPLVFTVNGGSCDVTSIKYRGTE
LSEGNTHLSSGLGSATVKVESVTANSVKYVKVTCTTSTLTHYMVVKEGESNVYLGTYIKQ
EPSVGELRFIARLKSSVLSEEYPYGKVSTTAGSSSTVEGSDVFVVNGETRSKFYSSTRFI
DKDAQCVYGGSDVIHVCVLAPHPESSSGGPFFRDIESNNAGAATNLYWYMNSNHVQTEAY
RTNVLHGPYVMTFSRSGIPKLRDIDTSFFSGLSITGYVPESGRGYVSGTASGVPSSFQTV
VHWYNSAAQYWAIASSKGAFKSPAMKPGTYTMVLYQGEYKVTTATGVSVSAGKTTSKNIA
STETTRNSLWKIGEYDGQPTGFLNADKFLRMHPSDKRMSPWKPATFTVGSSALNEFPMAL
FQTVNNPVTIKFNLKSAPGAATLRIATTLSYNGARPQAKINSFTAKAPAAPAKIDSRGVT
RGAYRGHGEVYDVSIPAGTLVAGDNTITITSISGSSGTTFLNPNFVSTIYEILLSYSN
Download sequence
Identical sequences A0A1Y2WLK8
jgi|DalEC12_1|241200|CE162438_2040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]