SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|303628|MIX4456_168_32 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|303628|MIX4456_168_32
Domain Number 1 Region: 15-328
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-71
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 436-656
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-21
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.062
Further Details:      
 
Domain Number 3 Region: 334-430
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000018
Family Rhamnogalacturonase B, RhgB, middle domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|303628|MIX4456_168_32
Sequence length 669
Sequence
MLFRIVSRCAYAEVVATENETQLVIQNDRLYTRVDKASGAMDAVVLDGQNLLGTRSGSTG
IFNLDCYCTPKGFWTPGSTQPTYELYSGTDSTGTSFGGIKMSDTYTPTGQVLEQYWFLRD
GETGLHVFSRIAYYNETTPFLRNLQEFRTLFRPNSDIWTHLATNGVQYAPLPGKEAKKNQ
VVVQDATWYMGNTPDDPYVQQEADYFTKYTFQDTWRNHDAHGMFADGSQIADNSTFGAWM
VMNTKETYFGGPLHSDLVVDGIVYDYMVSNHHGDQTPNITNGFDRTFGPQYFYFNHFPPG
TELQVLREDATQFASPEWNTEFYDSIAQYVPNYVPSKQRATWELQVNLPENAKNPIAVLS
QNGVDFQDNVFDTKAYQYWTEIDESGRATIPRVKEDTYRLTIYADGVFGQYVQDDVEVRA
GKVEKTQVKWEEESQGEEIFRIGTPDKSSGEYRHGYERDPTHPLHPEQYRIYWAVYDFVS
DFPEGVTFKVGESDVGKDLNYVHWSVFGGYANSLRTEPYVGDGNVNNWTVVFDLERSQLD
QKQQATFTVQLAGAKTAAGNTDVFNAFEPHANLAYTVNVNGKDLEPWIIPWHHSSSCAVR
SAVICYNIANKFIFDAGLLKEGENKIVLSLPFNATNYESAVLPNSVYVQYDALRLELSSA
KKCGRERAT
Download sequence
Identical sequences A0A1Y2XES8
jgi|DalEC12_1|303628|MIX4456_168_32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]