SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|322112|fgenesh1_kg.38_#_32_#_Locus1518v2rpkm14.08 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|DalEC12_1|322112|fgenesh1_kg.38_#_32_#_Locus1518v2rpkm14.08
Domain Number - Region: 63-115
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0141
Family Rhamnogalacturonase B, RhgB, middle domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|322112|fgenesh1_kg.38_#_32_#_Locus1518v2rpkm14.08
Sequence length 271
Sequence
MQISLSAALLGALTTLLAGPSAAAAAAASNSKSQRQQPQTTLTLWVPSSQSLPNPHVLPP
STHATLSALRASFDAPLTAAGSFVFRNVTPGSYLADIYCPTHAFAPLRIDVLEHTPADES
AAKKDGAAAGNALTVRAWETYRGNDWDNKGQEAPRSGSGFAVRALGPKEYFVERSSFSVL
SILKNPMILMGLVSMALFIGMPKLIENMDPEMRAEWEQQQKNNPMSSLMGGGQQPGANPM
GNFDMAAYLAGQNSNKKDGPEPADAKKGGKR
Download sequence
Identical sequences A0A1Y2WR98
jgi|DalEC12_1|322112|fgenesh1_kg.38_#_32_#_Locus1518v2rpkm14.08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]