SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|367654|estExt_Genemark1.C_160073 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|367654|estExt_Genemark1.C_160073
Domain Number 1 Region: 20-335
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.02e-73
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 444-662
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000162
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.081
Further Details:      
 
Weak hits

Sequence:  jgi|DalEC12_1|367654|estExt_Genemark1.C_160073
Domain Number - Region: 341-427
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00373
Family Rhamnogalacturonase B, RhgB, middle domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|367654|estExt_Genemark1.C_160073
Sequence length 665
Sequence
MVSLKALAFVTLTSGVKALLDASETRTQYILRNDDLSVAVSKSNGAVTQLSLGKQDLLGA
SSGSSGRGPYLDCSCIPSGFWTPGGTARFKLIKGTDSTGTPYGGVVMSDTYASTNQTLEQ
YWFLREGETGLHLFSRVTYFNQRTPFLRGLGELRTLFRPNTKLWTHLSGSEGNWAPFPSA
DANRRAITVQDATTYLGNSTNDPYVKQYSDYFTKYAFAEVWRDHDVHGQYSDGSTSSDGN
TYGAWLVHNTRETYYGGPLHSDLVVDGIVYNYLVSGHHGAPVPNITHGFDRTWGPQYYHF
NKGGPKTTLAELRADAAQYANPEWNSEFYDSIAQHVPNYAPSSKRTTFKATVELPEGAKR
PLAVLSENKQDFQLNVFDQSSLQYWADVNPETGAVEIPRVKEGTYRLTVYADGIFGWFIQ
DDVKISKSTSDSPFKFQWKPESAGKEIWRIGVPDKSAGEYKHGYAPDTSKPLQPEQYRVY
WANWDFPTDFPDGVRFKIGESKEAEDFNYIHWSFFPGKSNFFRPQPYYENVNNWTVEFNL
TRDQLADAKKATLTVELAGVKTANGNDKWASLPNEKYSNVPYTVAANGRDVETWIIPSYR
SGSCGVRSSVVCQNFGKKFEFSTDLLKEGVNELILSLPFNATNTETALLPGTIYLQYDAL
RFELS
Download sequence
Identical sequences A0A1Y2WXW0
jgi|DalEC12_1|367654|estExt_Genemark1.C_160073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]