SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|71364|e_gw1.64.63.1 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|71364|e_gw1.64.63.1
Domain Number 1 Region: 20-272
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.34e-63
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.00000054
Further Details:      
 
Domain Number 2 Region: 361-527
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.36e-45
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.00000899
Further Details:      
 
Domain Number 3 Region: 274-354
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000589
Family Rhamnogalacturonase B, RhgB, middle domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|71364|e_gw1.64.63.1
Sequence length 532
Sequence
MLGLSALLALALLSDSALAAFGLTTTSNRHKVDTNGGLVFEINRANGDVTSLVFNGVEYQ
GKGKASGINSGLGTSQVSAETIDNKYIKITAKANSLPVTQYYIAKPDDPTIYMATYITGE
VDPGELRWLARLRQENVPTGVHGDVGNTIGCTAFEGKDTFRCPNQQTRCKMYTSDRFIDD
QIHGVSGSNVAVWMIMPGVAYETSSGGPFMRDINSQTGSSDQELYWYMNSGHVRTEPWRF
GLMGPYAMKFTSKGDKPSSNLDTSFFSTLNIQGYVPDNQRGSVSGSVSGVPEEFEAVVHW
YNDKAQYWAKAANGAFKSPLMKPGTYTMKLYKGEYEVAKDTVTVTAGSNTAKDIASAEPS
PSVVWRIGNFDGQPLELKNGDKIERMHPSDVRMGSWGGTYTVGQSSARDFPMALFSKTGG
NAKVNFNLSANQVKDLTLRVGTTLSFKGGRPSVAMGGWTGKDPGAPKLIDSRGVTRGAYR
GYGEVYTWTVPASALKNGQNTLTLGVYGSGDKEFLSANYIIDAVELQGPAAS
Download sequence
Identical sequences A0A1Y2WLZ3
jgi|DalEC12_1|71364|e_gw1.64.63.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]