SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|51023|e_gw1.1.1266.1 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|51023|e_gw1.1.1266.1
Domain Number 1 Region: 75-218
Classification Level Classification E-value
Superfamily PH domain-like 4.15e-44
Family Ran-binding domain 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|51023|e_gw1.1.1266.1
Sequence length 248
Sequence
MTSTENTEPKVGETKPAETESKPLTSSSVFSMFGGGAKKEKKEDDDRGDVSGSAKAQREA
AAAAKGDDEAAPESEDVHFEPVHKLTEKVKTVTHEESEEEIFNMRCKMFKFTQDSEGKGE
WKERGTGPLRLLKHKENGKIRLVMRRDKTLKVCANHYITPEMTIAPMSTSDRAWLWNVGA
DVSEGEPEAITVSVRVANAENAQLFKEAWLKAQKENEALFAQARANVEKKEEPESKAEEK
KEEPAASS
Download sequence
Identical sequences A0A1Y2XFZ3
jgi|DalEC12_1|51023|e_gw1.1.1266.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]