SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386352378|ref|YP_006050625.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386352378|ref|YP_006050625.1|
Domain Number 1 Region: 16-86
Classification Level Classification E-value
Superfamily Homeodomain-like 5.2e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 92-178
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000035
Family Tetracyclin repressor-like, C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386352378|ref|YP_006050625.1|
Sequence length 252
Comment TetR family transcriptional regulator [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MEPDLRYHRFMATRDSTDSPRRRIVEAAVELLENGGPDAVSTRAVAAAAGMQPPAIYRLF
GDKEGLLEAVAEHGYARFLEKKREQLDPAPQDPVEELRRGWDMVVEFGVSRPELFAVMNR
ATGRGSDAAHRAGLEILHGRVRRLAAGGWLRVDEELAAQIIQATGQGAVTTWHSTPADRR
DPALLTVLRESMVAAVTRAEPAVPAAESGPAAAARALRAALPDDADVLSDAEQRLLREWL
TRLAADGGRPPT
Download sequence
Identical sequences G8XGB4
gi|386352378|ref|YP_006050625.1|NC_017585 gi|386352378|ref|YP_006050625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]