SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 69_10.2 > ENSSSCP00000000755

Domain assignment for ENSSSCP00000000755 from Sus scrofa 69_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000000755
Domain Number 1	Region: 361-447
Classification Level	Classification	E-value
Superfamily	DEATH domain	4.42e-24
Family	DEATH domain, DD	0.0000151
Further Details:

Domain Number 2	Region: 101-144
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	4.48e-17
Family	TNF receptor-like	0.00013
Further Details:

Domain Number 3	Region: 44-102
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000165
Family	TNF receptor-like	0.00012
Further Details:

Domain Number 4	Region: 145-198
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.0000000326
Family	TNF receptor-like	0.00039
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000000755 Gene: ENSSSCG00000000708 Transcript: ENSSSCT00000000771
Sequence length	459
Comment	pep:known chromosome:Sscrofa10.2:5:66780726:66793255:1 gene:ENSSSCG00000000708 transcript:ENSSSCT00000000771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGLPTVPGLLLPLVLRALLVDVYPAGVHGLVLHPGDREKRESLCPQGKYSHPQNRSICCT KCHKGTYLHNDCLGPGLDTDCRECDNGTFTASENHLTQCLSCSKCRSEMSQVEISPCTVD RDTVCGCRKNQYRKYWSETLFQCLNCSLCPNGTVQLPCLEKQDTICNCHSGFFLRDKECV SCVNCKNADCKNLCPATSETRNDFQDTGTTVLLPLVIFFGLCLAFFLFVGLACRYQRWKP KLYSIICGKSTPVKEGEALATAPSFGPITTFSPIPSFSPTTTFSPVPSFSPISSPTFTPC DWSNIKVTSPPKEIAPPPQGAGPILPMPPASTPVPTPLPKWGGSAHSAHSAPAQLADADP ATLYAVVDGVPPTRWKEFVRRLGLSEHEIERLELQNGRCLREAQYSMLAEWRRRTSRREA TLELLGSVLRDMDLLGCLEDIEEALRGPARLAPAPHLLR
Download sequence
Identical sequences	ENSSSCP00000000755 ENSSSCP00000000755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]