SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001945 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001945
Domain Number 1 Region: 130-204
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.75e-30
Family AN1-like Zinc finger 0.0000737
Further Details:      
 
Domain Number 2 Region: 15-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000011
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001945   Gene: ENSSSCG00000001779   Transcript: ENSSSCT00000001994
Sequence length 209
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:54475808:54542954:1 gene:ENSSSCG00000001779 transcript:ENSSSCT00000001994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNMAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPDEVLAGS
GYRITNTSSLSESLPVQCTDGSVPEAQSTPVPNQSLLSESVASSQVDSTSVDKAIPETED
LQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVH
NCSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences ENSSSCP00000001945 ENSSSCP00000001945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]