SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003109 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003109
Domain Number 1 Region: 241-332
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-19
Family I set domains 0.0093
Further Details:      
 
Domain Number 2 Region: 322-412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000753
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 29-142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000522
Family V set domains (antibody variable domain-like) 0.0013
Further Details:      
 
Domain Number 4 Region: 143-243
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000722
Family I set domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003109   Gene: ENSSSCG00000002887   Transcript: ENSSSCT00000003190
Sequence length 413
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:40216765:40221043:1 gene:ENSSSCG00000002887 transcript:ENSSSCT00000003190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGASRLDMPLSLGSCSPTASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHG
VWYFNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNLSPELGGKYYF
RGDLGGYNQYTFSEHSVLDIINTPSIVVPPEVVAGTEVEVSCMVPDNCPELHPELSWLGH
EGLGEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQTSFPNTSLQFEGYASLNVK
YPPVIVEVNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGAVLQEAVAESLSLELDEVTP
AEDGVYACLAENAYGQDNRTVELSVMYAPWKPTVNGTVVAVEGETVSILCSTQSNPDPII
TIFKEKQILATVIYESELQLELPAVTPEDDGEYWCVAENQYGQRATAFNLSVE
Download sequence
Identical sequences ENSSSCP00000003109 ENSSSCP00000003109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]