SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003611 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000003611
Domain Number - Region: 83-114
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0659
Family TNF receptor-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003611   Gene: ENSSSCG00000003330   Transcript: ENSSSCT00000003697
Sequence length 155
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:58019251:58021622:1 gene:ENSSSCG00000003330 transcript:ENSSSCT00000003697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRGVRLALCGFALLCALGLGQRPAGRSSCGAGRLLRGTGTNARCCRSCARAEGVCPET
DCECIQPEFHCGDPQCKSCKRYSCPPGQEAQPEGNFNFGFKCVDCVAGTFSGGHEGHCKP
WADCSQFGFLTTFPXNKTHNAVCSPGPRPLSRTAC
Download sequence
Identical sequences ENSSSCP00000003611 ENSSSCP00000003611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]