SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003841 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003841
Domain Number 1 Region: 25-115
Classification Level Classification E-value
Superfamily Fibronectin type III 6.2e-21
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003841   Gene: ENSSSCG00000003540   Transcript: ENSSSCT00000003932
Sequence length 158
Comment pep:novel chromosome:Sscrofa10.2:6:75712223:75723972:-1 gene:ENSSSCG00000003540 transcript:ENSSSCT00000003932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAGRWASLLLCLLQSAPGRLHLAPPQNVTLLSRDFGVYLTWLPGPGNPQNVTYFVAYQ
SSATPKRWQRVKMCARTKELVCSLMCLEKQDLCNKFKGRVQAVSPSARSPWVESKSMDYL
FEVEPAPPVLVFNRTEEILSVNATYQLPHCVPQPDLTM
Download sequence
Identical sequences ENSSSCP00000003841 ENSSSCP00000003841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]