SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006414 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006414
Domain Number 1 Region: 207-287
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000288
Family DEATH domain, DD 0.026
Further Details:      
 
Domain Number 2 Region: 36-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000135
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000266
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 292-366
Classification Level Classification E-value
Superfamily DEATH domain 0.00000559
Family Caspase recruitment domain, CARD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006414   Gene: ENSSSCG00000020707   Transcript: ENSSSCT00000006590
Sequence length 401
Comment pep:known chromosome:Sscrofa10.2:4:21129676:21158444:-1 gene:ENSSSCG00000020707 transcript:ENSSSCT00000006590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLLCCALVFLDISIKWTTQETFPPKYLHYDPETSKQLMCDKCPPGTSLKQHCTARRKT
VCAPCPDHYYTDSWHTSDECLYCTPVCKELQYVKQECNRTHNRVCECEEGRYLELEFCLK
HRSCPPGFGVLHAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSALGLLLTQKGNAT
HDNICSGNSESTHKCGIDVTLCEEAFFRFAVPTKLTPNWLSVLVDNLPGTKLNAESVERI
KRRHSSQEQTFQLLKLWKHQNKDQDMVKKIIQGIDLCENSVQKHIGHMNLTFEQLRILMQ
SLPGKKVPTEDIEETVKMCKSSEQILKLLSLWRIKNGDQDTRKGLMHALKHLKTYHFPKT
VTQSLKKIIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences ENSSSCP00000006414 ENSSSCP00000006414 9823.ENSSSCP00000006414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]