SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006928 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000006928
Domain Number - Region: 57-125
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00262
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006928   Gene: ENSSSCG00000006501   Transcript: ENSSSCT00000007120
Sequence length 203
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:102753769:102764968:1 gene:ENSSSCG00000006501 transcript:ENSSSCT00000007120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTLSSGLRGPLKGLWGAHEMRLLAFVVLTLFAVTQAEEGARLLASKSLLNRYAVEGRDL
TLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKA
GYFNFTSATITYLAQEDGPVVIGFTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPS
IGIPLLLWYSSKRKYDTPKTKKN
Download sequence
Identical sequences ENSSSCP00000006928 ENSSSCP00000006928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]