SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007632 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007632
Domain Number 1 Region: 291-618
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.45e-75
Family Pancreatic carboxypeptidases 0.00000243
Further Details:      
 
Domain Number 2 Region: 113-275
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00043
Further Details:      
 
Domain Number 3 Region: 623-720
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.51e-17
Family Carboxypeptidase regulatory domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007632   Gene: ENSSSCG00000007170   Transcript: ENSSSCT00000007843
Sequence length 733
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:37216087:37222981:1 gene:ENSSSCG00000007170 transcript:ENSSSCT00000007843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLLLALATFAPAVGVSLGAPSASVLGLAPPGTTKAPVPSPAPRSSPTEPPAGKENGTS
EHHVRIRVIKKKKIIMKKRKKLTHPRPPVTAGPSVTTSPAGTLDLPEKQEPGCPPLGLES
LRVSDNQLDASSSQSFGLGPHRGRLNIQSGLEDGDLFDGAWCAEQQDAEPWLQVDARHPT
RFSGVITQGRNSIWRYDWVTSYKVQFSNDSRTWWGSKNRSSGMDAVFPANSDPETPVMNL
LPEPQVARFIRLLPQTWLEGGAACLRAEILACPVSDPNSLFPEVPMLGSSDPLDFRHHDY
KAMRKLMKQVNEQCPNITRVYSIGKSHQGLKLYVMEMSDQPGEHELGEPEVRYVAGMHGN
EALGRELLLLLMQFLCHEFLRGDPRVTRLLTEMRIHLLPSMNPDGYETAFRRGSELVGWA
EGRWNHQGIDLNHNFADLNTPLWEAEDDGLVPDTVPNHHLPLPTYYTLPNATVAPETRAV
IKWMERIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDEAVFRWLSTVYAGTNRA
MQDPDRRPCHSQDFSSYGNVINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENE
LPQEWENNKDALLTYLEQQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYW
RLLTPGDYMVTASAEGYHTVTRSCRVTFEEGPVPCNFHLTKTPKQRLRELLAAGAKVPPD
LRRRLERLRGQKD
Download sequence
Identical sequences ENSSSCP00000007632 ENSSSCP00000007632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]