SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007928 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007928
Domain Number 1 Region: 26-79
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000000565
Family TNF receptor-like 0.0015
Further Details:      
 
Domain Number 2 Region: 102-162
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000576
Family TNF receptor-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007928   Gene: ENSSSCG00000007440   Transcript: ENSSSCT00000008144
Sequence length 278
Comment pep:known chromosome:Sscrofa10.2:17:53931894:53943334:1 gene:ENSSSCG00000007440 transcript:ENSSSCT00000008144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLPLKCLLWGCFLTAVHPEPPTSCKENQYPTNSRCCNLCPPGQKLVNHCTEVTETECL
PCSSSEFLATWNREKHCHQHKYCDPNLGLQVQREGTSKTDTTCVCSEGHHCTNSACESCT
LHSLCFPGLGVKQMATEVSDTICEPCPVGFFSNVSSASEKCQPWTSCESKGLVEQRAGTN
KTDVVCGFQSRMRALVVIPITLGILFAVLLVFLCIRKVTKEQETKALHPKTERQDPVETI
DLEDFPDSTAPVQETLHWCQPVTQEDGKESRISVQERE
Download sequence
Identical sequences A0A0B8RT44 Q8SQ34
ENSSSCP00000007928 NP_999359.1.46622 ENSSSCP00000007928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]