SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008709 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008709
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.8e-31
Family Toll/Interleukin receptor TIR domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008709   Gene: ENSSSCG00000008158   Transcript: ENSSSCT00000008935
Sequence length 172
Comment pep:known chromosome:Sscrofa10.2:3:54285206:54288704:-1 gene:ENSSSCG00000008158 transcript:ENSSSCT00000008935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDGKTYDAFVSYLKECRPENGEEYTFAVEILPRVLEKHFGYKLCIFERDVVPGRAVVDEI
HSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVGDFTFLPQSL
KLLKSHRVLKWKAEKSLSYNSRFWKNLRYLMPAKTVKPCGDESEVLPVLSQA
Download sequence
Identical sequences ENSSSCP00000008709 ENSSSCP00000008709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]