SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 69_10.2 > ENSSSCP00000010288

Domain assignment for ENSSSCP00000010288 from Sus scrofa 69_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000010288
Domain Number 1	Region: 300-397
Classification Level	Classification	E-value
Superfamily	DEATH domain	6.77e-18
Family	DEATH domain, DD	0.0069
Further Details:

Domain Number 2	Region: 36-75
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000001
Family	TNF receptor-like	0.0045
Further Details:

Domain Number 3	Region: 76-136
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000377
Family	TNF receptor-like	0.0024
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000010288 Gene: ENSSSCG00000009636 Transcript: ENSSSCT00000010564
Sequence length	407
Comment	pep:known chromosome:Sscrofa10.2:14:8076243:8084520:-1 gene:ENSSSCG00000009636 transcript:ENSSSCT00000010564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LLLVTAAQVKIVTAASGMPTGQGRFHQQMAAPEAGSLGRWKCPPGFHVEEASGECVRCTD GVDYTSHPNTLFSCLRCTVCKSGEEEKTPCTATADTRCECKPGTFREENSSEFCQKCHTR CPDGMVMATPCTPSSDLKCVHQESGTRASGEALDPGEPVTMNLQPPTASSPSSSNSLLAA GIAVLLVVVPLAVVIARWLCKCKVQDGPWGLGLSSRGAEPPLRRSHPSRGPEALDNARNN TLSNRDGLSSPVSDQEVEDPEQVEPTALQSSGEAEHLLEPAAAEGSRVRRGPLVPADGED PTECLRQFFDDFSTIVPYDCWDKLMRKMGLTQNEILQSRDRARSTGDALYEMLETWVRRR GREASVNDLLDALEALGQRYAKEKIEDTLVGSGKFIFKESEAGAAVS
Download sequence
Identical sequences	9823.ENSSSCP00000010288 ENSSSCP00000010288 ENSSSCP00000010288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]