SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010289 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010289
Domain Number 1 Region: 48-86
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000073
Family TNF receptor-like 0.002
Further Details:      
 
Domain Number 2 Region: 88-126
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000183
Family TNF receptor-like 0.00058
Further Details:      
 
Domain Number 3 Region: 127-156
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000145
Family TNF receptor-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010289   Gene: ENSSSCG00000009637   Transcript: ENSSSCT00000010565
Sequence length 187
Comment pep:known chromosome:Sscrofa10.2:14:7996225:8001752:-1 gene:ENSSSCG00000009637 transcript:ENSSSCT00000010565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKRIFKSLKMGERWKFCLVLEVTAASAMPTRQERVHQQFNVPQGWRRNFWELCPPGYHVS
EDGKNCTSCIHGVDFTIYWNVLPSCLPCTTCKSGEEEKTPCTATADTRCECKPGTFREEN
SPEFCQKCHTRCPDGMVMATPCTPSSDLKCMDQESGTRGSGEAPDLGEPVTTNLQPPTAS
SPSSGNS
Download sequence
Identical sequences 9823.ENSSSCP00000010289 ENSSSCP00000010289 ENSSSCP00000010289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]