SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011235 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011235
Domain Number 1 Region: 17-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.38e-80
Family Pancreatic carboxypeptidases 0.000000817
Further Details:      
 
Domain Number 2 Region: 340-419
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.35e-20
Family Carboxypeptidase regulatory domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011235   Gene: ENSSSCG00000010545   Transcript: ENSSSCT00000011536
Sequence length 461
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:120628012:120658801:-1 gene:ENSSSCG00000010545 transcript:ENSSSCT00000011536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLVAIFLHLLLFKLVAPVTFRHHRYDDLVRTLYKVHNECPYITRVYSIGRSVKGRHLY
VLEFSDYPGNHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNGNQRIVRLVEST
RIHILPSMNPDGYEVAAAQGRNISGYLIGRNNANGVDLNRNFPDLNTYIYYNEKNGGPNH
HLPLPDNWKSQVEPETQAVIQWIRSFNFVLSANLHGGAVVANYPYDKSLEHRVRGFRHPT
TTPTPDDKLFQKLAKVYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTN
CFEITLELSCDKFPPQEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLADAVISV
SGINHDVTSGAQGDYFRLLLPGTYTVTATAPGFDPETVSVTVGPGEPKLVNFQLKRSTPP
AAPKKRVPNSGQRVKVLPKKVQPRAARKKEMKKKQTQRAPA
Download sequence
Identical sequences F1S8V7
ENSSSCP00000011235 ENSSSCP00000011235 9823.ENSSSCP00000011235 XP_003483585.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]