SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011623 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011623
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Homeodomain-like 2.14e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000038
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 65-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000296
Family LIM domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000011623
Domain Number - Region: 161-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00311
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011623   Gene: ENSSSCG00000010903   Transcript: ENSSSCT00000011930
Sequence length 397
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:25357387:25369573:1 gene:ENSSSCG00000010903 transcript:ENSSSCT00000011930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGM
PPLSPEKPALCAGCGGKIADRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL
VYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIV
NYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALSPLGTAT
TLTDLTNPTVTVVTAVTSHMDSHESGSPSQTTLTNLF
Download sequence
Identical sequences A0A287AJK3
ENSSSCP00000011623 XP_005668042.1.46622 ENSSSCP00000011623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]