SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015815 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015815
Domain Number 1 Region: 1067-1399
Classification Level Classification E-value
Superfamily NHL repeat 1.94e-24
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1369-1388,1415-1557
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000034
Family All0351-like 0.081
Further Details:      
 
Domain Number 3 Region: 762-833
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000235
Family Pre-dockerin domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015815   Gene: ENSSSCG00000014894   Transcript: ENSSSCT00000016249
Sequence length 2600
Comment pep:known chromosome:Sscrofa10.2:9:14329065:14562328:-1 gene:ENSSSCG00000014894 transcript:ENSSSCT00000016249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGLQNHSRLRTPPPPLSHAHGPNQHHAASVSSLNRGNFTPRSNPSPAPTDHSLSGEPVAG
AQEPAHAQDNWLLNSNIPLETRNLGKQPFLGTLQDNLIEMDILSASRHDGAYSDGHFLFK
PGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFSRPAFNLKKPSKYCNWKCAALSAIV
ISAALVILLAYFVAMHLFGLNWHLQPLEGQMYEITEDTASSWPVPTDVSLYPSGGTGLEI
PDRKGKGATEGKPSGFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQVFIDHPVHLKFNV
SLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGPQRQSRGAVPPSSHET
GFIQYLDSGIWHLAFYNDGKESEVVSFFTTAIVRLESCLSDCQLMKGCIQGYYRYFLSWK
GEAGSVLGCCLLCCGPGQVLRGPINCHQTSGSPVPTAQKSRITTNCGSHGTCPCETGVQC
KPAMYKGLNEVTEKVTXLPPSCSPSSLPPTTDCSHSFIGEGLLGCESKRPYCVNSFSFWS
TFKNTANCDHTRSNAWCSKSDTSLLCASYTECGGRHCTSCVPGTCQHDSGWLNNGCESRA
LAPRDLLELKPTCCRKEGRAGCHAWHTGSNYKSPFSPTDLNGRKLMSLGNHGAFHLTQAA
WKAFKPSRKADSTCSHAQEDDGPGSTDFASPDCILVAGYCWTGRLCISSFLPLDIHKTVQ
EPPASLTSRHKDLSQIVFIPGDSDVTLVPYSHPCENGHACVIRGQVMTSDGTPLVGVNIS
FVNNPLFGYTISRQDGSFDLVTNGGISITLRFERAPFITQEHTLWLPWDRFFVMETIIMR
HEENEIPSCDLSNFARPSPVLSPSPMTSFASSCAEKGPIVPEIQALQEEIAISGCKMRLS
YLSSRTPGYKAVLRIRLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTD
VYNQKVFGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHALNIQ
SGILHKGNGENQFVSQQPPVIGSVMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGS
LYVGDFNYIRRIFPSGNVTNILELSHSPAHKYYLTTDPMSGAVFLSDTNSRRVFKIKSTV
VAKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKSGLIYFVDGTMI
RRIDQNGVISTLLGSNDLTSARPLSCDSVMDISQVRLEWPTDLAVNPMDNSLYVLDNNVV
LQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHNGVLYIAETDEK
KINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNTPSSLAVCADGE
LYVADLGNIRIRFIRKNKPFLNTQNMYELSSPIDQELYLFDTSGRHLYTQSLPTGDYLYN
FTYTGDGDVTLITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVTTQGHE
LAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSVHVQVE
TSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLLAG
TVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFDRVTRT
EKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPGGHIAGIQRGIMSERMEYDQ
SGRLTSRIFADGKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVARQTLETI
RSVGYYRNIYQPPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLSKLAEMLYDTTK
VSFAYDETAGMLKTITLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDYNYDNSF
RVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYG
RMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYAYEYDADGQLQTVSIND
KPLWRYSYDLNGNLHLLSPGNSARLTPLRYDLRDRITRLGDVQYKVDEDGFLRQRGSDVF
EYNSAGLLIKAYNRGGGWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLTNPTKVTHLYNH
SSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILYTAYGEIY
MDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKHLSSSNIMPFNL
YMFKNNNPISNAQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDTDAMEPSYELSHTQMK
TQEWDNSKSILGVQCEVQKQLKAFVTLERFEQLYGSTITSCQQAPETKKFASSGSVFGKG
VKFALKDGRVTTDIISVANEDGRRVAAILNNAHYLENLHFTIDGVDTHYFVKPGPSDGDL
AILGLSGGRRTLENGVNVTVSQINTMLNGRTRRYTDIQLQYGALCLNTRYGTTLDEEKVR
VLELARQRAVRQAWAREQQRLRDGEEGLRAWTEGEKQQALNTGRVQGYDGFFVISVEQYP
ELSDSATNIHFMRQSEMGRR
Download sequence
Identical sequences ENSSSCP00000015815 ENSSSCP00000015815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]