SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015845 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015845
Domain Number 1 Region: 1-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.63e-65
Family L-arabinose binding protein-like 0.00000000571
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015845
Domain Number - Region: 278-326
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000895
Family TNF receptor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015845   Gene: ENSSSCG00000021425   Transcript: ENSSSCT00000016281
Sequence length 338
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:24421829:24660150:-1 gene:ENSSSCG00000021425 transcript:ENSSSCT00000016281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLL
MAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPE
TNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSM
AYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYE
IMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSHIIRSVCSEPCEKGQIKVIRKGE
VSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGT
Download sequence
Identical sequences ENSSSCP00000015845 ENSSSCP00000015845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]