SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015846 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015846
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.55e-25
Family L-arabinose binding protein-like 0.0000249
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000015846
Domain Number - Region: 109-156
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000341
Family TNF receptor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015846   Gene: ENSSSCG00000014925   Transcript: ENSSSCT00000016282
Sequence length 158
Comment pep:known chromosome:Sscrofa10.2:9:24389772:24399882:1 gene:ENSSSCG00000014925 transcript:ENSSSCT00000016282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFVINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILF
DENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSHIIRSVCSEPCE
KGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACXA
Download sequence
Identical sequences ENSSSCP00000015846 ENSSSCP00000015846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]