SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016566 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016566
Domain Number 1 Region: 94-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000154
Family I set domains 0.06
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016566
Domain Number - Region: 297-338
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0353
Family TNF receptor-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016566   Gene: ENSSSCG00000015627   Transcript: ENSSSCT00000017021
Sequence length 350
Comment pep:known chromosome:Sscrofa10.2:9:149631286:149713217:-1 gene:ENSSSCG00000015627 transcript:ENSSSCT00000017021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASAPDRARRGWRRARAAGSPLSRAAVVLLLSALVLRAPPSVGYLDRLPRSFHLTQESA
KIVGSPNFPVKVYVMLHQKSPHVLCVTQRLRNFELVDPSFQWHGPKGKIVSENSTAQVTS
TGSLVFQNFEESMSGVYTCFLEYKPTVEEVVKNLQLKYIIYAYREPRYYYQFTARYHAAP
CNSIYNISFEKKLLQILSKLVLDLSCEVSLLKSECHRVKMQRAGLQNELFFTFSVSSLDT
EKGPKPCAGHSCESSKRLSKAKNLIERFFNQQVEVLGRRAEPLPEIYYIEGTLQMVWINR
CFPGYGMNILKHPKCPECCVICSPGTYNSRDGIHCLQCNSSLVFGAKACL
Download sequence
Identical sequences F1SF28
ENSSSCP00000016566 ENSSSCP00000016566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]