SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016714 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016714
Domain Number 1 Region: 442-517
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000255
Family Pre-dockerin domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016714
Domain Number - Region: 281-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 185-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000194
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 251-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000225
Family Integrin beta EGF-like domains 0.065
Further Details:      
 
Domain Number - Region: 117-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 318-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 152-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00189
Family Integrin beta EGF-like domains 0.043
Further Details:      
 
Domain Number - Region: 87-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00356
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 217-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0576
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016714   Gene: ENSSSCG00000015774   Transcript: ENSSSCT00000017175
Sequence length 2282
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:50897901:50993934:1 gene:ENSSSCG00000015774 transcript:ENSSSCT00000017175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLTCPYLQYDFVELLDGSRLIAREQRNLLESERAGRQARSVSLHEAGFIQYLDSGIWHLA
FYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECVSGTCHCFPGFLGPDCSRAACPVLCS
GNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGENCEEADC
LDPGCSNHGVCIHGECHCNPGWGGNNCEILKTMCPDQCSGHGTYLQESGSCTCDPNWTGP
DCSNEICPVDCGPHGVCMGGTCRCEEGWTGPSCNQRACHPRCAEHGTCKDGKCECSQGWN
GEHCTIAHYLDKIVKEGCPGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVAMETLCTDSK
DNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDIISQSLQSPSQQAAKSFYDRISFLI
GSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGYTITRQDGMFDL
VANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSCDLSGFVRPNPI
IVSSPLSTFFRSSPEDSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQS
VIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEY
ESCLDLTLWEKRTAILQGYELDASNMGGWTLNKHHVLDVQNGTLKKNGGRGTFFLKSADN
LGKLRAGYRKSVFSCFFFLLSPWKKTLAALRMICKRFYQQITYVHVFLPPSPAPHLLRIQ
TLHHTHTHLKTDFLDLISFQSLGSLWFLKQDPQRCEEREATWSIWQLCKDGFNEIRCNLV
TECKGPPQNNECKRGGRKRPRTQARPDSESLHSLRLLFFLPVVHLGFPNHWHLISPLMPL
SLLCSFSQLKCDPLLALPDVHLQQQKKSYTYTSDSALEYLNDGVDNSVLLSHNDRSHVTG
KRPSSRGSRGVLKKVSQHCKLFLPEYICRINSPLTFLAPSCTEAESMSRGMDSMGRLLLV
PGIKAFQKTKNSLSSDTCSGPPSAASWTLRGPSNLAASCDGKCLPSRTGNVGLNGARKHK
PVKGSEKGRSIQKDVNSFLKLFYSFFFSLTPLSLHVYNCYYNPLHFFPSPGNFCLSPENV
GSIMHIYDNRARMPRWRAVLFTLALTACLKSSRCTAHAQRQILPHICAANVDRALSSKKL
LRVPSLTPMPLFFSYDSEGRLTNVTFPTGVVTNLHGDMDKAITVDIESSSREEDVSITSN
LSSIDSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLAGTANPTVAKRNMT
LPGENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLL
RIAYDTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFADG
KTWSYTYLEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNP
PESNASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGVL
KTVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNARFDYSYDNSFRVTSMQGVINET
PLPIDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEIFRS
LMYWITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYNYDLNG
NLHLLNPSNSARLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGTEIFEYSSKGLLTRVY
SKGSGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTYPTRITHVYNHSSSEITSLYYDL
QGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNIDFQLVIG
FHGGLYDPLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKDPAPFNLYMFRNNNPASKIH
DVKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWDDVPPIFGVQQQV
ARQAKAFLSLGKMAEVQVSRRRGSGAPSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIA
NEDCIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTSTPESDLGTLRLTSGRKALENGINV
TVSQSTTVVNGRTRRFADVEMQFGALALHVRYGMTLDEEKARILEQARQRALARAWAREQ
QRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIG
KR
Download sequence
Identical sequences ENSSSCP00000016714 ENSSSCP00000016714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]