SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018376 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018376
Domain Number 1 Region: 49-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000568
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Domain Number 2 Region: 273-362
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000336
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018376
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0876
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018376   Gene: ENSSSCG00000017344   Transcript: ENSSSCT00000018880
Sequence length 413
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:18712333:18713574:-1 gene:ENSSSCG00000017344 transcript:ENSSSCT00000018880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPAHTTVLLWVWGSLQAFEIVEKENIFQRTPCPAFLMFDNAAYLADMSFELPCHCKPEE
VAAVVWYYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLVRFSIRMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQSGEGMVATFKDQGQEPFADEYHGSLRVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPDLSPRYRRTLPDVVSCGSRAVPRPLRAKVSDHTPELLVRSC
LVPCETTKIQKGVMAIFNYVSKVGSRPWLPQVPIQFHQQRLGHGLIISCPGARPEHAVAW
DKDRQYLYRTQYLRGVNRSMRVFIDHGNHLHIRFTQLEDRGIYYCWRQGERIAGFRLGVT
QRGRYPASFSDPETRAALRLTLIGYLLITAVFVTVHLCRCCCHLFRCWPDLSP
Download sequence
Identical sequences F1RR01
ENSSSCP00000018376 ENSSSCP00000018376 XP_005668801.1.46622 9823.ENSSSCP00000018376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]